1. Recombinant Proteins
  2. Others
  3. ARRB1/Beta-Arrestin 1 Protein, Human (His)

ARRB1/Beta-Arrestin 1 Protein, Human (His) expresses in E. coli with a His tag. ARRB1/beta-Arrestin 1, found in the hypothalamus (ARH) and in N-38 neurons, is a scaffolding protein organizing downstream signaling molecules and as an adaptor protein aiding in ER internalization after its activation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

ARRB1/Beta-Arrestin 1 Protein, Human (His) expresses in E. coli with a His tag. ARRB1/beta-Arrestin 1, found in the hypothalamus (ARH) and in N-38 neurons, is a scaffolding protein organizing downstream signaling molecules and as an adaptor protein aiding in ER internalization after its activation[1].

Background

β-arrestins binds to phosphorylated receptors, uncouple G proteins and link receptors to clathrin-dependent internalization pathways. β-arrestins may be crucial not only for limiting E2 signaling via membrane estrogen receptor-α (mERα) internalization, but may be involved in the initial estradiol (E2) membrane-initiated signaling (EMS) through an ERK1/2 pathway[1].

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P49407 (M1-R418)

Gene ID

408  [NCBI]

Molecular Construction
N-term
ARRB1 (M1-R418)
Accession # P49407
6*His
C-term
Synonyms
rHuARRB1/beta-Arrestin 1, His; ARRB1, β-Arrestin 1
AA Sequence

MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNRHHHHHH

Molecular Weight

Approximately 60.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized a 0.2 μm filtered solution of PBS, pH7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

ARRB1/Beta-Arrestin 1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ARRB1/Beta-Arrestin 1 Protein, Human (His)
Cat. No.:
HY-P7606
Quantity:
MCE Japan Authorized Agent: