ARRB1/Beta-Arrestin 1 Protein, Human (His)

ARRB1/Beta-Arrestin 1 Protein, Human (His) expresses in E. coli with a His tag. ARRB1/beta-Arrestin 1, found in the hypothalamus (ARH) and in N-38 neurons, is a scaffolding protein organizing downstream signaling molecules and as an adaptor protein aiding in ER internalization after its activation^[1].

β-arrestins binds to phosphorylated receptors, uncouple G proteins and link receptors to clathrin-dependent internalization pathways. β-arrestins may be crucial not only for limiting E2 signaling via membrane estrogen receptor-α (mERα) internalization, but may be involved in the initial estradiol (E2) membrane-initiated signaling (EMS) through an ERK1/2 pathway^[1].

Human

E. coli

C-6*His

P49407 (M1-R418)

408  [NCBI]

MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNRHHHHHH

Approximately 60.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized a 0.2 μm filtered solution of PBS, pH7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Angela M Wong, et al. β-arrestin regulates estradiol membrane-initiated signaling in hypothalamic neurons. PLoS One. 2015 Mar 24;10(3):e0120530.  [Content Brief]