1. Recombinant Proteins
  2. Others
  3. ASAM/CLMP Protein, Human (HEK293, His)

ASAM/CLMP Protein, Human (HEK293, His)

Cat. No.: HY-P7609
SDS COA Handling Instructions

ASAM/CLMP Protein, Human (HEK293, His), a recombinant human ASAM/CLMP produced in HEK293 cells, has a His tag. ASAM/CLMP belongs to the CTX (cortical thymocyte marker in Xenopus) family, whose members are type I transmembrane proteins within the immunoglobulin superfamily (IgSF). ASAM/CLMP is a component of epithelial tight junctions. ASAM/CLMP has been implicated in adipocyte maturation and development of obesity. Mutations of the CLMP gene cause Congenital Short Bowel Syndrome (CSBS).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $95 In-stock
50 μg $285 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

ASAM/CLMP Protein, Human (HEK293, His), a recombinant human ASAM/CLMP produced in HEK293 cells, has a His tag. ASAM/CLMP belongs to the CTX (cortical thymocyte marker in Xenopus) family, whose members are type I transmembrane proteins within the immunoglobulin superfamily (IgSF). ASAM/CLMP is a component of epithelial tight junctions. ASAM/CLMP has been implicated in adipocyte maturation and development of obesity. Mutations of the CLMP gene cause Congenital Short Bowel Syndrome (CSBS)[1].

Background

The Coxsackie and adenovirus receptor CXADR or CAR, also known as CAR-like membrane protein (CLMP) acts as a highaffinity receptor for the coxsackie B virus and adenovirus (Ad) serotypes 2 and 5 and belongs to the Junction Adhesion Molecule (JAM) family within the immunoglobulin (Ig) superfamily (IgSF) of proteins that localise in tight junctions and along the lateral membrane of epithelial cells[1].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9H6B4 (T19-M233)

Gene ID
Molecular Construction
N-term
ASAM (T19-M233)
Accession # Q9H6B4
6*His
C-term
Synonyms
rHuASAM/CLMP, His; CXADR-like membrane protein; CLMP; ACAM; ASAM
AA Sequence

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKESCVVRVTVQYVQSIGMHHHHHH

Molecular Weight

Approximately 35.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

ASAM/CLMP Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ASAM/CLMP Protein, Human (HEK293, His)
Cat. No.:
HY-P7609
Quantity:
MCE Japan Authorized Agent: