1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. Azoreductase/NQO1 Protein, Mouse (P.pastoris, His)

Azoreductase/NQO1 Protein, Mouse (P.pastoris, His)

Cat. No.: HY-P71831
SDS COA Handling Instructions Technical Support

The azoreductase/NQO1 protein reduces quinones to hydroquinone using NADH or NADPH as an electron donor.Azoreductase/NQO1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Azoreductase/NQO1 protein, expressed by P.pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The azoreductase/NQO1 protein reduces quinones to hydroquinone using NADH or NADPH as an electron donor.Azoreductase/NQO1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Azoreductase/NQO1 protein, expressed by P.pastoris , with N-6*His labeled tag.

Background

Azoreductase/NQO1 protein, a flavin-containing quinone reductase, plays a pivotal role in cellular redox regulation by catalyzing the two-electron reduction of quinones to hydroquinones, utilizing either NADH or NADPH as electron donors. Operating through a ping-pong kinetic mechanism, the enzyme sequentially transfers electrons from NAD(P)H to its flavin cofactor and then from the reduced flavin to the quinone, thereby bypassing the formation of semiquinone and reactive oxygen species. This process serves as a key component in quinone detoxification, regulating the cellular redox state. Azoreductase/NQO1 also contributes to the reduction of plasma membrane redox system components, such as coenzyme Q and vitamin quinones, generating antioxidant hydroquinone forms and potentially acting as a superoxide scavenger. Moreover, the protein exhibits versatility in its actions, as it can alternatively activate quinones and their derivatives, producing redox-reactive hydroquinones with DNA cross-linking antitumor potential. Furthermore, Azoreductase/NQO1 functions as a gatekeeper of the core 20S proteasome, interacting with tumor suppressors TP53 and TP73 in a NADH-dependent manner to inhibit their ubiquitin-independent degradation during oxidative stress.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

P. pastoris

Tag

N-6*His

Accession

Q64669 (A2-K274)

Gene ID
Molecular Construction
N-term
6*His
NQO1 (A2-K274)
Accession # Q64669
C-term
Synonyms
Nqo1; Dia4; Nmo1; Nmor1; NAD(P)H dehydrogenase [quinone] 1; EC 1.6.5.2; Azoreductase; DT-diaphorase; DTD; Phylloquinone reductase; Quinone reductase 1; QR1
AA Sequence

AARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETVWEETPLYFAPSSLFDLNFQAGFLMKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK

Molecular Weight

Approximately 33 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCI, 0.5 M NaCI, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Azoreductase/NQO1 Protein, Mouse (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Azoreductase/NQO1 Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P71831
Quantity:
MCE Japan Authorized Agent: