CD276/B7-H3 Protein, Human (435a.a, HEK293, Fc)

CD276/B7-H3 Protein, Human (HEK293, Fc) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. B7-H3 is an immune checkpoint from the B7 family of molecules.

As a member of the B7 family, inducible co-stimulator ligand (ICOSLG) expressed on tumor cell has been reported to have an important role in tumor immunity. As the counter ligand of ICOS, a CD28-related molecule, ICOSLG is expressed on professional antigen-presenting cell (APCs; such as dendritic cells (DCs) and B cells) and on some tumor cells (such as glioma cells and gastric carcinoma cells). ICOSLG is the only B7 family member that preferentially co-stimulates type 2T helper cell (Th2) responses, and interestingly, this unique molecule has a critical role in antitumor immunity. ICOSLG expression on solid tumors (implanted-transfected tumors) aids in both NK mediated and CD8⁺ cytotoxic T cell (CTL) activation and killing. Several studies using ICOSLG-transfected solid tumor cell lines found that ICOSLG induced CD8⁺ cytotoxic lymphocyte-mediated tumor regression^[1].

Human

HEK293

C-hFc

Q5ZPR3-1 (L29-P463)

80381  [NCBI]

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP

62-65 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48(1):124-8.  [Content Brief]