1. Recombinant Proteins
  2. Immune Checkpoint Proteins CAR-T Related Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. B7-H3 B7-H3/CD276
  5. CD276/B7-H3 Protein, Mouse (HEK293, His)

CD276/B7-H3 Protein, Mouse (HEK293, His) is induced upon T cell activation. B7-H3 selectively increases the production of IFN-γ.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CD276/B7-H3 Protein, Mouse (HEK293, His) is induced upon T cell activation. B7-H3 selectively increases the production of IFN-γ[1].

Background

Interaction of B7-H3 and its T cell counter-receptor induces proliferation of both CD4+ and CD8+ T cells and enhances the induction of cytotoxic T cells (CTLs). B7-H3 has the four conserved cysteine residues that thought to be involved in the formation of V- and C-like Ig domains[1].
Human B7-H3 binds to activated T cells and costimulates their proliferation and, most potently, IFN-γ production. Mouse B7-H3 does not bind significantly to CD4 or CD8 cells from C57BL/6 lymph node cells[2].

Biological Activity

Loaded Vobramitamab (HY-P99101) on AHC2 biosensor, can bind CD276/B7-H3 Protein, Mouse (HEK293, His) with an affinity constant of 1.825E-09 M as determined in BLI assay.

  • Loaded Vobramitamab (HY-P99101) on AHC2 biosensor, can bind CD276/B7-H3 Protein, Mouse (HEK293, His) with an affinity constant of 1.825E-09 M as determined in BLI assay.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q8VE98 (V29-F244)

Gene ID
Molecular Construction
N-term
CD276 (V29-F244)
Accession # Q8VE98
6*His
C-term
Synonyms
rMuB7-H3, His; CD276 antigen; CD276; B7 homolog 3; B7-H3; CD276
AA Sequence

VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFHHHHHH

Molecular Weight

Approximately 38.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD276/B7-H3 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7639
Quantity:
MCE Japan Authorized Agent: