1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. B7-H4
  5. B7-H4 Protein, Human (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells to suppress tumor-associated antigen-specific T cell immunity. B7-H4 Protein, Human (HEK293, His) is the recombinant human-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The B7-H4 protein acts as a negative regulator, inhibiting T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells to suppress tumor-associated antigen-specific T cell immunity. B7-H4 Protein, Human (HEK293, His) is the recombinant human-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Background

B7-H4 protein functions as a negative regulator of the T-cell-mediated immune response, exerting inhibitory effects on T-cell activation, proliferation, cytokine production, and the development of cytotoxicity. Particularly significant when expressed on the cell surface of tumor macrophages, B7-H4, in collaboration with regulatory T-cells (Treg), plays a crucial role in suppressing tumor-associated antigen-specific T-cell immunity. Additionally, B7-H4 is implicated in the promotion of epithelial cell transformation, indicating its multifaceted involvement in modulating immune responses and cellular processes associated with tumor development.

Biological Activity

Immobilized Recombinant Human B7-H4 / B7S1 / B7x Protein (His Tag) at 2 μg/mL (100 μL/well) can bind B7-H4 / B7S1 / B7x, Rabbit Pab , the EC50 is 1.5-4 ng/mL.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q7Z7D3-1 (F29-A258)

Gene ID
Molecular Construction
N-term
B7-H4 (F29-A258)
Accession # Q7Z7D3-1
His
C-term
Synonyms
V-set domain containing T-cell activation inhibitor 1; VTCN1; Protein B7S1; B7-H4
AA Sequence

FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA

Molecular Weight

Approximately 43-48 kDa of the apparent molecular mass.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% Trehalose, 5% Mannitol, 0.01% Tween-80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

B7-H4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B7-H4 Protein, Human (HEK293, His)
Cat. No.:
HY-P74395
Quantity:
MCE Japan Authorized Agent: