B7-H4 Protein, Mouse (HEK293, Fc)

B7-H4 Protein, Mouse (HEK293, Fc) may participate in negative regulation of cell-mediated immunity in peripheral tissues. Cell-associated B7-H4 could also inhibit T cell response. B7-H4 acts as a morphogenic factor for cancer cells^[1][2][3].

Human B7-H4 mRNA is expressed in spleen, lung, and thymus. B7-H4 expression can be induced on T cells, B cells, monocytes, and DC after in vitro stimulation^[1].
Mouse B7-H4 transcript is detected in the heart, lung, liver, skeletal muscle, kidneys, and testis but not in brain and spleen^[1].
B7-H4 is a cancer promoter and a potentially important therapeutic target^[3].

Mouse

HEK293

C-hFc

Q7TSP5/AAH32925.1 (F29-P258)

242122  [NCBI]

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIRSSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLQLLNSGP

70-90 kDa

Greater than 95% as determined by reducing SDS-PAGE. 

Lyophilized powder.

Lyophilized after extensive dialysis against PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Gabriel L Sica, et al. B7-H4, a molecule of the B7 family, negatively regulates T cell immunity. Immunity. 2003 Jun;18(6):849-61.  [Content Brief]

  [2]. Joseph R Podojil, et al. Potential targeting of B7-H4 for the treatment of cancer. Immunol Rev. 2017 Mar;276(1):40-51.  [Content Brief]

  [3]. Yun Qian, et al. B7-H4 enhances oncogenicity and inhibits apoptosis in pancreatic cancer cells. Cell Tissue Res. 2013 Jul;353(1):139-51.  [Content Brief]