1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Stimulatory Immune Checkpoint Molecules
  4. B7-H6
  5. B7-H6 Protein, Human (HEK293, His)

B7-H6 Protein, Human (HEK293, His) suppresses the initiation of the “caspase cascade” and induces anti-apoptosis by STAT3 pathway activation to provoke tumorigenesis.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

B7-H6 Protein, Human (HEK293, His) suppresses the initiation of the “caspase cascade” and induces anti-apoptosis by STAT3 pathway activation to provoke tumorigenesis[1][12].

Background

B7 homolog 6 (B7-H6), a novel member of the B7 family, was identified on tumor cell surfaces in 2009[1]. B7 homolog 6 (B7-H6) has been identified as involved in tumorigenesis. B7-H6 induces cellular cytotoxicity, secretion of TNF-α and IFN-γ and B7-H6-specific BiTE triggers T cells to accelerate tumorigenesis. B7-H6 induces abnormal immunological progression by HER2-scFv mediated ADCC and NKp30 immune escape to promote tumorigenesis. B7-H6 promotes tumorigenesis via apoptosis inhibition, proliferation and immunological progression. B7-H6 may a valuable potential biomarker and therapeutic strategy for diagnostics, prognostics and treatment in cancer[2].

Biological Activity

Immobilized recombinant Human B7 Homolog 6, His (HEK293-expressed) (rHuB7-H6, His) at 2μg/ml (100 μL/ well) can bind NCR3-Fc. The ED50 of recombinant Human B7 Homolog 6, His (HEK293-expressed) (rHuB7-H6, His) is 6.40 ug/mL.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q68D85 (D25-S262)

Gene ID
Molecular Construction
N-term
B7-H6 (D25-S262)
Accession # Q68D85
6*His
C-term
Synonyms
rHuB7-H6, His; B7 homolog 6; B7-H6; NCR3LG1; Natural cytotoxicity triggering receptor 3 ligand 1
AA Sequence

DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSHHHHHH

Molecular Weight

40-60 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

B7-H6 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B7-H6 Protein, Human (HEK293, His)
Cat. No.:
HY-P7631
Quantity:
MCE Japan Authorized Agent: