1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. BCA-1/CXCL13
  6. BCA-1/CXCL13 Protein, Rat (His-GST)

The BCA-1/CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. As part of this family, BCA-1/CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. BCA-1/CXCL13 Protein, Rat (His-GST) is the recombinant rat-derived BCA-1/CXCL13 protein, expressed by E. coli , with N-GST, N-6*His labeled tag. The total length of BCA-1/CXCL13 Protein, Rat (His-GST) is 86 a.a., with molecular weight of 41 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BCA-1/CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. As part of this family, BCA-1/CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. BCA-1/CXCL13 Protein, Rat (His-GST) is the recombinant rat-derived BCA-1/CXCL13 protein, expressed by E. coli , with N-GST, N-6*His labeled tag. The total length of BCA-1/CXCL13 Protein, Rat (His-GST) is 86 a.a., with molecular weight of 41 kDa.

Background

The BCA-1/CXCL13 protein is a member of the intercrine alpha (chemokine CxC) family, signifying its role within a group of chemokines essential for intercellular communication and immune responses. As part of the intercrine alpha family, BCA-1/CXCL13 likely plays a pivotal role in modulating inflammatory processes and influencing cellular interactions. Further exploration is crucial to unveil the specific functions and implications of this protein within the broader context of the chemokine CxC family, underscoring its significance in mediating immune responses.

Biological Activity

Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with human CXCR5. The ED50 for this effect is 1.049 μg/mL, corresponding to a specific activity is 953.289 U/mg.

  • Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with human CXCR5. The ED50 for this effect is 1.049 μg/mL, corresponding to a specific activity is 953.289 U/mg.
Species

Rat

Source

E. coli

Tag

N-GST

Accession

Q5I0J6 (L23-A108)

Gene ID
Molecular Construction
N-term
GST
CXCL13 (L23-A108)
Accession # Q5I0J6
C-term
Synonyms
rHuBCA-1/CXCL13; C-X-C motif chemokine 13; BCA1; BLC; SCYB13
AA Sequence

LETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA

Molecular Weight

41 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BCA-1/CXCL13 Protein, Rat (His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BCA-1/CXCL13 Protein, Rat (His-GST)
Cat. No.:
HY-P700547
Quantity:
MCE Japan Authorized Agent: