1. Recombinant Proteins
  2. Cytokines and Growth Factors CAR-T Related Proteins CD Antigens
  3. TNF Superfamily B Cell CD Proteins
  4. TNF Receptor Superfamily BCMA/CD269
  5. B Cell Maturation Antigen (BCMA)
  6. BCMA/TNFRSF17 Protein, Mouse (HEK293, His-Fc)

BCMA/TNFRSF17 Protein, Mouse (HEK293, His-Fc)

Cat. No.: HY-P72850
SDS COA Handling Instructions

B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM). BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells. BCMA/TNFRSF17 Protein, Mouse (HEK293, His-Fc) is a recombinant protein with a C-Terminal Fc label and a C-Terminal His label, It is produced in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $80 In-stock
50 μg $210 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM). BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells[1]. BCMA/TNFRSF17 Protein, Mouse (HEK293, His-Fc) is a recombinant protein with a C-Terminal Fc label and a C-Terminal His label, It is produced in HEK293 cells.

Background

BCMA is expressed preferentially by mature B lymphocytes, with minimal expression in hematopoietic stem cells or nonhematopoietic tissue[1]. BCMA is almost exclusively expressed on plasmablasts and PCs[2].
The amino acid sequence of human BCMA protein has low homology for mouse BCMA protein.
BCMA is a 184 amino acid and 20.2-kDa type III transmembrane glycoprotein, with the extracellular N terminus containing a conserved motif of 6 cysteines. BCMA has two agonist ligands: a proliferation-inducing ligand (APRIL) and B cell activating factor (BAFF). Upon binding of the ligands to BCMA, activates B cells (NF-κβ), rat sarcoma/mitogen-activated protein kinase (RAS/MAPK), and phosphoinositide-3-kinase-protein kinase B/Akt (PI3K-PKB/Akt) signaling pathway. These pathways result in proliferation stimulation by modulating cell cycle checkpoints, increasing survival by upregulating anti-apoptotic proteins, and production of cell adhesion molecules, angiogenesis factors, and immunosuppressive molecules[2].
BCMA can be used as a promising antigen to target using a variety of immuno-therapy treatments including CART cells, for MM patients[3]. BCMA markedly reduces plasma IgA, IgG, and IgM levels and splenic Ig heavy chain mRNA levels in mouse[4]. In BCMA−/− mice, the long-term survival of PCs is impaired, but lack of BCMA has no effect in short-lived PCs, B cell development, or early humoral immune response, and the splenic architecture and germinal centers appear intact in these BCMA-deficient mice[5]. BCMA overexpression significantly promotes in vivo growth of xenografted MM cells in murine models[6].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized human BAFF at 10 μg/mL (100 μl/well) can bind mouse BCMA-Fch, The EC50 of mouse BCMA-Fch is 0.02-0.06 μg/mL.

Species

Mouse

Source

HEK293

Tag

C-hFc;C-His

Accession

O88472 (M1-T49)

Gene ID
Molecular Construction
N-term
BCMA (M1-T49)
Accession # O88472
hFc-8*His
C-term
Synonyms
Tumor necrosis factor receptor superfamily member 17; CD269; TNFRSF17; BCM; BCMA
AA Sequence

MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYT

Molecular Weight

35-48 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BCMA/TNFRSF17 Protein, Mouse (HEK293, His-Fc)
Cat. No.:
HY-P72850
Quantity:
MCE Japan Authorized Agent: