BD-1 Protein, Rat

BD-1 Protein, Rat is antimicrobial peptide that defends epithelial surfaces including the skin, gastrointestinal, and respiratory tracts.

Beta Defensin-1 displays potent microcidal properties, and also plays a part in other aspects of innate and adaptive immunity^[1]. Rat Beta Defensin-1 reduction may be in part responsible for the high incidence of urinary tract infections in diabetes mellitus^[2].

Measured by its anti-microbial activity against E. coli. The ED₅₀ for  this effect is 62.07 ng/mL, corresponding to a specific activity is 1.61×10^4 U/mg.

Rat

E. coli

Tag Free

O89117 (D33-S69)

83687  [NCBI]

DQYRCLQNGGFCLRSSCPSHTKLQGTCKPDKPNCCRS

Approximately 7 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM PBS, 500 mM NaCl, pH 7.0 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Semple F, et al. β-Defensins: multifunctional modulators of infection, inflammation and more? J Innate Immun. 2012;4(4):337-48.  [Content Brief]

  [2]. Hiratsuka T, et al. Nucleotide sequence and expression of rat beta-defensin-1: its significance in diabetic rodent models. Nephron. 2001 May;88(1):65-70.  [Content Brief]