1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Neurotrophins/NGF
  5. Brain Derived Neurotrophic Factor (BDNF)
  6. BDNF Protein, Human (CHO)

BDNF Protein, Human (CHO) is a neurotrophin binding to the high-affinity tropomyosin-related receptor kinase B (TrkB) receptor to regulate neurodevelopmental processes, including neuronal survival, neuronal differentiation, and synaptic plasticity.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
25 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

BDNF Protein, Human (CHO) is a neurotrophin binding to the high-affinity tropomyosin-related receptor kinase B (TrkB) receptor to regulate neurodevelopmental processes, including neuronal survival, neuronal differentiation, and synaptic plasticity.

Background

Recombinant Human BDNF/Brain-derived neurotrophic factor is a neurotrophin binding to the high-affinity tropomyosin-related receptor kinase B (TrkB) receptor to regulate neurodevelopmental processes, including neuronal survival, neuronal differentiation, and synaptic plasticity[1]. Brain-derived neurotrophic factor (BDNF) is one of the most abundant neurotrophins in the mammalian central nervous system that promotes neuronal survival and differentiation. BDNF plays crucial roles in the cardiovascular system[2].

Biological Activity

The ED50 is <4 μg/ml as measured by C6 cells. Immobilized Human BDNF at 5 μg/ml (100 μl/well) can bind NGF R, Human-Biotin with a linear range of 0.06-4 μg/ml.

Species

Human

Source

CHO

Tag

Tag Free

Accession

P23560 (H129-R247)

Gene ID

627  [NCBI]

Molecular Construction
N-term
BDNF (H129-R247)
Accession # P23560
C-term
Synonyms
rHuBDNF/Brain-derived neurotrophic factor; Abrineurin
AA Sequence

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Molecular Weight

12-14 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BDNF Protein, Human (CHO)
Cat. No.:
HY-P7116
Quantity:
MCE Japan Authorized Agent: