BDNF Protein, Human

Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt)^[1]. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB^[2]. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS^[1]. BDNF Protein, Human is a recombinant human BDNF (H129-R247) without tag, which is produced in E.coli.

BDNF, a neurotrophin that belongs to NGF-beta family. BDNF is widely expressed in the CNS, gut and other tissues. BDNF regulates neurodevelopmental processes, including maturation, survival and differentiation of neuronal populations, and synaptic plasticity^[1].
BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt), thereby inducing increased Ca²⁺ intake and phosphorylation of transcription factors. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB. The activation of p75NTR increases apoptotic and inflammatory signaling in neurons and glial cells by activation of c-Jun N-terminal kinases (JNK) and NF-κB expression, respectively^[2]. In human, decreased levels of BDNF are associated with neurodegenerative diseases (such as Parkinson's disease and Alzheimer's disease) and type 2 diabetes mellitus^[1]. Human BDNF shares >97% aa sequence identity with mouse and rat. Rat BDNF shares >99% aa sequence identity with mouse.
BDNF is a neurotransmitter modulator which is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory^[1].

BDNF (human, 50 ng/mL, 3 days) increases percentage of neurite-bearing cells in PC12 cells^[3].

BDNF (human, 0.25 μg/side, intrahippocampal administration) increases ERK1/2 and CREB activation and facilitated LTM in rats^[4].

1.Immobilized Human TrkB-His at 5 μg/mL (100 μl/well) can bind Human BDNF Biotinylated by NHS-biotin prior to testing. The ED₅₀ of Human BDNF is ≤6 ng/mL.
2.Immobilized Human TrkB-His at 2 μg/mL (100 μl/well) can bind Human BDNF Biotinylated by NHS-biotin prior to testing. The ED₅₀ of Human BDNF is <100 ng/mL.
3.Measured by its binding ability in a functional ELISA. When Recombinant Human BDNF is coated at 1 μg/mL (100 μL/well) can bind Recombinant Human TrkB. The ED₅₀ for this effect is 21.18 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human BDNF is coated at 1 μg/mL (100 μL/well) can bind Recombinant Human TrkB. The ED₅₀ for this effect is 21.18 ng/mL.

Human

E. coli

Tag Free

P23560-1 (H129-R247)

627  [NCBI]

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Approximately 13 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against 20 mM PB, 250 mM NaCl, pH 7.2 or 4 mM HCL, pH 0.8.

<0.01 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Bathina S, et al. Brain-derived neurotrophic factor and its clinical implications. Arch Med Sci. 2015 Dec 10;11(6):1164-78.  [Content Brief]

  [2]. Li M, et al. Recombinant human brain-derived neurotrophic factor prevents neuronal apoptosis in a novel in vitro model of subarachnoid hemorrhage. Neuropsychiatr Dis Treat. 2017 Apr 3;13:1013-1021.  [Content Brief]

  [3]. Lima Giacobbo B, et al. Brain-Derived Neurotrophic Factor in Brain Disorders: Focus on Neuroinflammation. Mol Neurobiol. 2019 May;56(5):3295-3312.  [Content Brief]

  [4]. Hang P, et al. Brain-derived neurotrophic factor attenuates doxorubicin-induced cardiac dysfunction through activating Akt signalling in rats. J Cell Mol Med. 2017 Apr;21(4):685-696.  [Content Brief]

  [5]. Egan MF, et al. The BDNF val66met polymorphism affects activity-dependent secretion of BDNF and human memory and hippocampal function. Cell. 2003 Jan 24;112(2):257-69.  [Content Brief]

  [6]. Alonso M, et al. Signaling mechanisms mediating BDNF modulation of memory formation in vivo in the hippocampus. Cell Mol Neurobiol. 2002 Dec;22(5-6):663-74.  [Content Brief]