BGLAP Protein, Mouse (His-SUMO)

The BGLAP protein, in its carboxylated state, forms an important part of the bone matrix and acts as a negative regulator of bone formation. It limits bone formation and preserves processes such as resorption and mineralization. BGLAP Protein, Mouse (His-SUMO) is the recombinant mouse-derived BGLAP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of BGLAP Protein, Mouse (His-SUMO) is 46 a.a., with molecular weight of ~24 kDa.

The BGLAP protein, in its carboxylated form, stands as a major organic constituent within the bone matrix, representing 1-2% of the total bone protein. In this carboxylated state, it serves as a negative regulator of bone formation, crucial for limiting bone formation while preserving the processes of bone resorption and mineralization. Notably, the carboxylated form exhibits strong binding affinity to apatite and calcium. Conversely, the uncarboxylated form functions as a hormone secreted by osteoblasts, exerting regulatory influence over diverse cellular processes. This includes its role in energy metabolism, where it acts as a hormone promoting pancreatic beta-cell proliferation, insulin secretion, insulin sensitivity, and energy expenditure. Moreover, the uncarboxylated osteocalcin hormone functions as a key player in male fertility by promoting testosterone production in the testes through its interaction with the G protein-coupled receptor GPRC6A. Additionally, it acts as a regulator of brain development, crossing the blood-brain barrier to initiate signaling responses that prevent neuronal apoptosis in the hippocampus, stimulate the synthesis of monoamine neurotransmitters, and inhibit gamma-aminobutyric acid (GABA) synthesis. Importantly, maternal osteocalcin, which crosses the placenta during pregnancy, plays a crucial role in fetal brain development.

Mouse

E. coli

N-6*His;N-SUMO

P86546 (Y50-I95)

12096  [NCBI]

YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI

Approximately 24 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.