1. Recombinant Proteins
  2. Others
  3. BGLAP Protein, Mouse (His-SUMO)

The BGLAP protein, in its carboxylated state, forms an important part of the bone matrix and acts as a negative regulator of bone formation. It limits bone formation and preserves processes such as resorption and mineralization. BGLAP Protein, Mouse (His-SUMO) is the recombinant mouse-derived BGLAP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of BGLAP Protein, Mouse (His-SUMO) is 46 a.a., with molecular weight of ~24 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BGLAP protein, in its carboxylated state, forms an important part of the bone matrix and acts as a negative regulator of bone formation. It limits bone formation and preserves processes such as resorption and mineralization. BGLAP Protein, Mouse (His-SUMO) is the recombinant mouse-derived BGLAP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of BGLAP Protein, Mouse (His-SUMO) is 46 a.a., with molecular weight of ~24 kDa.

Background

The BGLAP protein, in its carboxylated form, stands as a major organic constituent within the bone matrix, representing 1-2% of the total bone protein. In this carboxylated state, it serves as a negative regulator of bone formation, crucial for limiting bone formation while preserving the processes of bone resorption and mineralization. Notably, the carboxylated form exhibits strong binding affinity to apatite and calcium. Conversely, the uncarboxylated form functions as a hormone secreted by osteoblasts, exerting regulatory influence over diverse cellular processes. This includes its role in energy metabolism, where it acts as a hormone promoting pancreatic beta-cell proliferation, insulin secretion, insulin sensitivity, and energy expenditure. Moreover, the uncarboxylated osteocalcin hormone functions as a key player in male fertility by promoting testosterone production in the testes through its interaction with the G protein-coupled receptor GPRC6A. Additionally, it acts as a regulator of brain development, crossing the blood-brain barrier to initiate signaling responses that prevent neuronal apoptosis in the hippocampus, stimulate the synthesis of monoamine neurotransmitters, and inhibit gamma-aminobutyric acid (GABA) synthesis. Importantly, maternal osteocalcin, which crosses the placenta during pregnancy, plays a crucial role in fetal brain development.

Species

Mouse

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P86546 (Y50-I95)

Gene ID
Molecular Construction
N-term
6*His-SUMO
BGLAP (Y50-I95)
Accession # P86546
C-term
Synonyms
Bglap; Osteocalcin; Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein
AA Sequence

YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI

Molecular Weight

Approximately 24 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BGLAP Protein, Mouse (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BGLAP Protein, Mouse (His-SUMO)
Cat. No.:
HY-P72103
Quantity:
MCE Japan Authorized Agent: