1. Recombinant Proteins
  2. Others
  3. Biglycan Protein, Human (HEK293, His)

Biglycan Protein, Human (HEK293, His)

Cat. No.: HY-P7663
SDS COA Handling Instructions

Biglycan Protein, Human (HEK293, His) is a recombinant human Biglycan produced in HEK293 cells with a His tag. Biglycan, a small leucine-rich proteoglycan, acts as a danger signal and is classically thought to promote macrophage recruitment via Toll-like receptors (TLR) 2 and 4.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
5 μg $60 In-stock
10 μg $100 In-stock
50 μg $300 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Biglycan Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Biglycan Protein, Human (HEK293, His) is a recombinant human Biglycan produced in HEK293 cells with a His tag. Biglycan, a small leucine-rich proteoglycan, acts as a danger signal and is classically thought to promote macrophage recruitment via Toll-like receptors (TLR) 2 and 4[1].

Background

Biglycan, a member of the family of small leucine-rich proteoglycans, is composed of glycosaminoglycan side chains covalently bound to a central core protein. It resides at the cell surface or in the pericellular space of various tissues. Biglycan has been implicated in the development and progression of human cancers[2].

Biological Activity

Measured by its ability to inhibit the cell growth of NIH-3T3 cells. The ED50 this effect is 1.427 μg/mL, corresponding to a specific activity is 700.7708 units/mg.

  • Measured by its ability to inhibit the cell growth of NIH-3T3 cells. The ED50 for this effect is 1.427 μg/mL, corresponding to a specific activity is 700.7708 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P21810 (E20-K368)

Gene ID

633  [NCBI]

Molecular Construction
N-term
Biglycan (E20-K368)
Accession # P21810
6*His
C-term
Synonyms
rHuBiglycan, His; Biglycan; BGN; SLRR1A
AA Sequence

EQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKKHHHHHH

Molecular Weight

40-90 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Biglycan Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Biglycan Protein, Human (HEK293, His)
Cat. No.:
HY-P7663
Quantity:
MCE Japan Authorized Agent: