BMP-13/GDF-6 Protein, Mouse

The BMP-13/GDF-6 protein is a multifunctional growth factor that plays a critical role in retinal development, control of apoptosis, and dorsoventral positional information. It is critical for bone and joint development in various anatomical regions, influencing species-specific skeletal changes and contributing to the evolution of unique anatomical features. BMP-13/GDF-6 Protein, Mouse is the recombinant mouse-derived BMP-13/GDF-6 protein, expressed by E. coli , with tag free. The total length of BMP-13/GDF-6 Protein, Mouse is 120 a.a., with molecular weight of ~13.7 kDa.

BMP-13/GDF-6 Protein, a versatile growth factor, orchestrates critical roles in cellular processes, including the regulation of proliferation and differentiation in both the retina and bone formation. Its pivotal involvement in retinal development includes the control of apoptosis and the establishment of dorsal-ventral positional information, crucial for the formation of the retinotectal map. Moreover, BMP-13/GDF-6 is indispensable for the normal development of bones and joints in various anatomical regions, such as limbs, skull, digits, and axial skeleton. Its significance extends to shaping species-specific changes in skeletal structures, suggesting a role in the evolution of distinct anatomical features. This multifaceted growth factor positively regulates chondrogenic tissue differentiation through specific receptor subunits, including BMPR1A, BMPR1B, BMPR2, and ACVR2A, activating the SMAD1-SMAD5-SMAD8 complex. Notably, the regulation of chondrogenic differentiation faces inhibition by NOG. Additionally, BMP-13/GDF-6 participates in the induction of adipogenesis from mesenchymal stem cells, employing growth factor receptor subunits BMPR1A, BMPR2, and ACVR2A, along with the activation of SMAD1-SMAD5-SMAD8 complex and MAPK14/p38. This intricate molecular ballet unfolds through homodimerization, forming disulfide-linked structures.

Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED₅₀ for this effect is typically 0.85-5 µg/mL.

• 
  Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED₅₀ this effect is 1.808 μg/mL, corresponding to a specific activity is 553.097 units/mg.

Mouse

E. coli

Tag Free

P43028 (T335-R454)

242316  [NCBI]

TAFASRHGKRHGKKSRLRCSRKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR

Approximately 13.7 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from sterile 50 mM Tris-HCL, 300 mM NaCL, 500 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 300 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.