1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Growth Differentiation Factor
  5. Growth Differentiation Factor 6 (GDF-6)
  6. BMP-13/GDF-6 Protein, Mouse

The BMP-13/GDF-6 protein is a multifunctional growth factor that plays a critical role in retinal development, control of apoptosis, and dorsoventral positional information. It is critical for bone and joint development in various anatomical regions, influencing species-specific skeletal changes and contributing to the evolution of unique anatomical features. BMP-13/GDF-6 Protein, Mouse is the recombinant mouse-derived BMP-13/GDF-6 protein, expressed by E. coli , with tag free. The total length of BMP-13/GDF-6 Protein, Mouse is 120 a.a., with molecular weight of ~13.7 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE BMP-13/GDF-6 Protein, Mouse

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BMP-13/GDF-6 protein is a multifunctional growth factor that plays a critical role in retinal development, control of apoptosis, and dorsoventral positional information. It is critical for bone and joint development in various anatomical regions, influencing species-specific skeletal changes and contributing to the evolution of unique anatomical features. BMP-13/GDF-6 Protein, Mouse is the recombinant mouse-derived BMP-13/GDF-6 protein, expressed by E. coli , with tag free. The total length of BMP-13/GDF-6 Protein, Mouse is 120 a.a., with molecular weight of ~13.7 kDa.

Background

BMP-13/GDF-6 Protein, a versatile growth factor, orchestrates critical roles in cellular processes, including the regulation of proliferation and differentiation in both the retina and bone formation. Its pivotal involvement in retinal development includes the control of apoptosis and the establishment of dorsal-ventral positional information, crucial for the formation of the retinotectal map. Moreover, BMP-13/GDF-6 is indispensable for the normal development of bones and joints in various anatomical regions, such as limbs, skull, digits, and axial skeleton. Its significance extends to shaping species-specific changes in skeletal structures, suggesting a role in the evolution of distinct anatomical features. This multifaceted growth factor positively regulates chondrogenic tissue differentiation through specific receptor subunits, including BMPR1A, BMPR1B, BMPR2, and ACVR2A, activating the SMAD1-SMAD5-SMAD8 complex. Notably, the regulation of chondrogenic differentiation faces inhibition by NOG. Additionally, BMP-13/GDF-6 participates in the induction of adipogenesis from mesenchymal stem cells, employing growth factor receptor subunits BMPR1A, BMPR2, and ACVR2A, along with the activation of SMAD1-SMAD5-SMAD8 complex and MAPK14/p38. This intricate molecular ballet unfolds through homodimerization, forming disulfide-linked structures.

Biological Activity

Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is typically 0.85-5 µg/mL.

  • Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 this effect is 1.808 μg/mL, corresponding to a specific activity is 553.097 units/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P43028 (T335-R454)

Gene ID
Molecular Construction
N-term
BMP-13 (T335-R454)
Accession # P43028
C-term
Synonyms
Growth/differentiation factor 6; Gdf6; GDF-6; Bone morphogenetic protein 13; BMP-13; Growth/differentiation factor 16; Growth Differentiation Factor 6
AA Sequence

TAFASRHGKRHGKKSRLRCSRKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR

Molecular Weight

Approximately 13.7 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from sterile 50 mM Tris-HCL, 300 mM NaCL, 500 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 300 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BMP-13/GDF-6 Protein, Mouse
Cat. No.:
HY-P79333
Quantity:
MCE Japan Authorized Agent: