1. Recombinant Proteins
  2. Others
  3. BNIP3/NIP3 Protein, Human (His)

BNIP3/NIP3 Protein, Human (His) expresses in E. coliwith a His tag. BNIP3 belongs to the Bcl-2 protein family that regulates programmed cell death.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

BNIP3/NIP3 Protein, Human (His) expresses in E. coliwith a His tag. BNIP3 belongs to the Bcl-2 protein family that regulates programmed cell death[1].

Background

BNIP3 is an atypical BH3-only protein that is induced by hypoxia-inducible factor 1 (HIF1) under hypoxia[2].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human BNIP3 Protein at 2 μg/mL (100 μL/well) can bind Anti-BNIP3 Antibody, The ED50 for this effect is 13.08 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human BNIP3 Protein at 2 μg/mL (100 μL/well) can bind Anti-BNIP3 Antibody, The ED50 for this effect is 13.08 ng/mL.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

AAH21989.1 (M1-L166)

Gene ID

664  [NCBI]

Molecular Construction
N-term
6*His
BNIP3 (M1-L166)
Accession # AAH21989.1
C-term
Synonyms
rHuBNIP3, His; BNIP3; NIP3; BCL2/Adenovirus E1B 19 kDa Protein-Interacting Protein 3
AA Sequence

MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFL

Molecular Weight

Approximately 22-28.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4 or 20 mM Tris-HCL, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

BNIP3/NIP3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BNIP3/NIP3 Protein, Human (His)
Cat. No.:
HY-P7670
Quantity:
MCE Japan Authorized Agent: