BNIP3/NIP3 Protein, Human (His)

BNIP3/NIP3 Protein, Human (His) expresses in E. coliwith a His tag. BNIP3 belongs to the Bcl-2 protein family that regulates programmed cell death^[1].

BNIP3 is an atypical BH3-only protein that is induced by hypoxia-inducible factor 1 (HIF1) under hypoxia^[2].

Measured by its binding ability in a functional ELISA. Immobilized Human BNIP3 Protein at 2 μg/mL (100 μL/well) can bind Anti-BNIP3 Antibody, The ED₅₀ for this effect is 13.08 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human BNIP3 Protein at 2 μg/mL (100 μL/well) can bind Anti-BNIP3 Antibody, The ED₅₀ for this effect is 13.08 ng/mL.

Human

E. coli

N-6*His

AAH21989.1 (M1-L166)

664  [NCBI]

MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFL

Approximately 22-28.0 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS, pH 7.4 or 20 mM Tris-HCL, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Swoboda E, et al. BNIP3 jako nietypowy przedstawiciel rodziny Bcl-2. Cześć 2: Regulacja ekspresji i aktywności BNIP3 oraz jego rola w chorobie nowotworowej [BNIP3 as an atypical representative of the Bcl-2 protein family. Part 2: Regulation of the expression and activity of BNIP3 protein and its role in tumorigenesis]. Postepy Hig Med Dosw (Online). 2009;63:418-424. Published 2009 Sep 10.  [Content Brief]

  [2]. Park CW, et al. BNIP3 is degraded by ULK1-dependent autophagy via MTORC1 and AMPK. Autophagy. 2013;9(3):345-360.  [Content Brief]