1. Recombinant Proteins
  2. Others
  3. BPIFA1 Protein, Human

BPIFA1 Protein, a lipid-binding protein, exhibits high specificity for the surfactant phospholipid DPPC. It plays a crucial role in the innate immune responses of the upper airways, reducing surface tension, inhibiting biofilm formation by pathogenic bacteria, and negatively regulating proteolytic cleavage of SCNN1G, contributing to airway surface liquid homeostasis. BPIFA1 may also attract macrophages and neutrophils. BPIFA1 Protein, Human is the recombinant human-derived BPIFA1 protein, expressed by E. coli , with tag free. The total length of BPIFA1 Protein, Human is 237 a.a., with molecular weight of 24.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BPIFA1 Protein, a lipid-binding protein, exhibits high specificity for the surfactant phospholipid DPPC. It plays a crucial role in the innate immune responses of the upper airways, reducing surface tension, inhibiting biofilm formation by pathogenic bacteria, and negatively regulating proteolytic cleavage of SCNN1G, contributing to airway surface liquid homeostasis. BPIFA1 may also attract macrophages and neutrophils. BPIFA1 Protein, Human is the recombinant human-derived BPIFA1 protein, expressed by E. coli , with tag free. The total length of BPIFA1 Protein, Human is 237 a.a., with molecular weight of 24.8 kDa.

Background

BPIFA1 protein, a lipid-binding molecule with a distinct affinity for the surfactant phospholipid dipalmitoylphosphatidylcholine (DPPC), plays a pivotal role in the innate immune responses within the upper airways. By reducing surface tension in airway secretions and impeding biofilm formation by pathogenic Gram-negative bacteria, such as P. aeruginosa and K. pneumoniae, BPIFA1 contributes to the host's defense mechanisms. Furthermore, it negatively regulates the proteolytic cleavage of SCNN1G, a crucial event for the activation of the epithelial sodium channel (ENaC), thereby maintaining airway surface liquid homeostasis and facilitating proper mucus clearance. BPIFA1 also participates in the inflammatory response following exposure to irritants and may attract immune cells like macrophages and neutrophils. Structurally, BPIFA1 functions as a monomer and interacts with SCNN1B, a subunit of the heterotrimeric ENaC, inhibiting its proteolytic activation. This multifaceted role highlights the importance of BPIFA1 in orchestrating various aspects of airway defense and homeostasis.

Biological Activity

Measured by its ability to bind fluorescein-conjugated E. coli Bioparticles. The ED50 for this effect is 3.382 μg/mL.

  • Measured by its ability to bind fluorescein-conjugated E. coli Bioparticles. The ED50 for this effect is 3.382 μg/mL.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9NP55-1 (Q20-V256)

Gene ID
Molecular Construction
N-term
BPIFA1 (Q20-V256)
Accession # Q9NP55-1
C-term
Synonyms
BPI fold-containing family A member 1; Lung-specific protein X; PLUNC1; SPLUNC1; Von Ebner protein Hl;
AA Sequence

QFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV

Molecular Weight

Approximately 24.8 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.22μm filtered solution of 50mM Tris, 150mM NaCl, 10% Glycerol, pH 8.5 or PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

BPIFA1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BPIFA1 Protein, Human
Cat. No.:
HY-P700957
Quantity:
MCE Japan Authorized Agent: