BPIFA2 Protein, Human (HEK293, His)

The BPIFA2 protein, also known as bactericidal/permeability-increasing fold family A member 2, has significant antibacterial activity, particularly against Pseudomonas aeruginosa. The protein is effective against bacterial infections caused by Pseudomonas aeruginosa, a pathogen known to be resistant to many antibiotics. BPIFA2 Protein, Human (HEK293, His) is the recombinant human-derived BPIFA2 protein, expressed by HEK293 , with C-His, C-6*His labeled tag. The total length of BPIFA2 Protein, Human (HEK293, His) is 231 a.a., with molecular weight of ~35 kDa.

BPIFA2 protein, also known as bactericidal/permeability-increasing fold-containing family A member 2, exhibits remarkable antibacterial activity, specifically against Pseudomonas aeruginosa. This protein has the ability to effectively combat bacterial infections caused by Pseudomonas aeruginosa, a pathogenic bacterium known to be resistant to many antibiotics. The potent antibacterial activity of BPIFA2 protein suggests its potential as a therapeutic agent or as a target for the development of novel antibacterial strategies against Pseudomonas aeruginosa infections. Further exploration is required to fully understand the underlying mechanisms of action and the potential clinical applications of BPIFA2 protein.

Human

HEK293

C-His;C-6*His

Q96DR5 (E19-I249)

140683  [NCBI]

ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Approximately 35 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.