1. Recombinant Proteins
  2. CD Antigens
  3. Dendritic Cell CD Proteins
  4. BST-2/CD317
  5. BST2 Protein, Human (HEK293, His)

BST2 Protein, Human (HEK293, His) is a recombinant human bone marrow stromal antigen 2 produced in HEK293 cells. Bone marrow stromal antigen 2 (BST-2; also known as tetherin or CD317) is an IFN-inducible gene that functions to block the release of a range of nascent enveloped virions from infected host cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

BST2 Protein, Human (HEK293, His) is a recombinant human bone marrow stromal antigen 2 produced in HEK293 cells. Bone marrow stromal antigen 2 (BST-2; also known as tetherin or CD317) is an IFN-inducible gene that functions to block the release of a range of nascent enveloped virions from infected host cells[1].

Background

Bone marrow stromal antigen 2 is induced by type I interferon produced in response to viral infections, as well as in certain cancers. Bone marrow stromal antigen 2 has been shown to be a host restriction factor of virus multiplication through its ability to physically tether budding virions and restrict viral spread[2].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human BST-2/Tetherin is immobilized at 1 µg/mL (100 µL/well) can bind Biotinylated Recombinant Dengue virus 4. The ED50 for this effect is 3.753 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human BST-2/Tetherin is immobilized at 1 µg/mL (100 µL/well) can bind Biotinylated Recombinant Dengue virus 4.The ED50 for this effect is 3.753 μg/mL.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q10589 (N49-S161)

Gene ID

684  [NCBI]

Molecular Construction
N-term
BST2 (N49-S161)
Accession # Q10589
6*His
C-term
Synonyms
rHuBST2, His; Bone Marrow Stromal Antigen 2; BST-2
AA Sequence

NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSHHHHHH

Molecular Weight

20-30 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE. Due to glycosylation, the protein exhibits an apparent molecular weight of around 23-26 kDa in SDS-PAGE conducted under reducing conditions.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

BST2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BST2 Protein, Human (HEK293, His)
Cat. No.:
HY-P7673
Quantity:
MCE Japan Authorized Agent: