BTLA/CD272 Protein, Rat (HEK293, mFc)

BTLA/CD272 protein inhibits antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. It regulates immune responses through cis and trans interactions with TNFRSF14. In cis, it maintains resting state in naive T cells, while in trans, it supports survival signals in effector T cells. BTLA/CD272 interacts with PTPN6/SHP-1, PTPN11/SHP-2, and TNFRSF14/HVEM. BTLA/CD272 Protein, Rat (HEK293, mFc) is the recombinant rat-derived BTLA/CD272 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of BTLA/CD272 Protein, Rat (HEK293, mFc) is 154 a.a., with molecular weight of ~55-77 kDa.

BTLA/CD272 protein serves as an inhibitory receptor on lymphocytes, exerting negative regulation on antigen receptor signaling through PTPN6/SHP-1 and PTPN11/SHP-2. It engages in both cis and trans interactions with TNFRSF14. In cis interactions, BTLA/CD272 plays an immune regulatory role, inhibiting trans interactions in naive T cells to maintain a resting state. Conversely, in trans interactions, it can predominate during adaptive immune responses, providing survival signals to effector T cells. The protein interacts with tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 and also engages with TNFRSF14/HVEM through its cysteine-rich domain 1.

Measured by its binding ability in a functional ELISA. When Mouse HVEM/TNFRSF14 is immobilized at 0.5 μg/mL(100 μL/well)can bind Recombinant Rat BTLA. The ED₅₀ for this effect is approximately 1.083 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Mouse HVEM/TNFRSF14 is immobilized at 0.5 μg/mL（100 μL/well）can bind Recombinant Rat BTLA. The ED₅₀ for this effect is approximately 1.083 μg/mL.

Rat

HEK293

C-mFc

Q6PNM1 (K30-Y183)

407756  [NCBI]

KEPTKRIGEECRVQLKIKRNSSRSAWTGELFKIECPVTYCVHRPNVTWCKHNGTRCVPLEVGPQLHTSWVENDQASAFVLYFEPIHLSDDGVYTCSANLNSEVINSHSVVIHVTERTQNCSEHPLITASDIPDATNASRPSTMEERPGRTWLLY

Approximately 55-77 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.