BTN2A2 Protein, Human (Biotinylated, HEK293, Fc-Avi)

BTN2A2 protein inhibits CD4 and CD8 T-cell proliferation activated by anti-CD3 antibodies. It regulates T-cell metabolism, suppressing IL2 and IFNG cytokine secretion. BTN2A2 plays a pivotal role in immune response modulation, maintaining immune homeostasis by limiting T-cell activation and effector functions. BTN2A2 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived BTN2A2 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of BTN2A2 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 205 a.a., with molecular weight of 55-80 kDa.

BTN2A2 protein functions as an inhibitor, impeding the proliferation of both CD4 and CD8 T-cells that are activated by anti-CD3 antibodies. Additionally, it exerts regulatory control over T-cell metabolism and suppresses the secretion of the cytokines IL2 and IFNG. This inhibition reflects BTN2A2's pivotal role in modulating immune responses and maintaining immune homeostasis by limiting the activation and effector functions of T-cells.

Human

HEK293

C-Avi;C-hFc

Q8WVV5 (Q33-V237)

10385  [NCBI]

QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETV

55-80 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.