1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Butyrophilins
  4. Butyrophilin Like 8 (BTNL8)
  5. BTNL8 Protein, Human (HEK293, hFc)

BTNL8 protein potentially stimulates the primary immune response by affecting sub-optimally stimulated T-cells through the TCR/CD3 complex. It promotes T-cell proliferation and enhances cytokine production. BTNL8 Protein, Human (HEK293, hFc) is the recombinant human-derived BTNL8 protein, expressed by HEK293, with C-hFc labeled tag. The total length of BTNL8 Protein, Human (HEK293, hFc) is 221 a.a., with molecular weight of approximately 65 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BTNL8 protein potentially stimulates the primary immune response by affecting sub-optimally stimulated T-cells through the TCR/CD3 complex. It promotes T-cell proliferation and enhances cytokine production. BTNL8 Protein, Human (HEK293, hFc) is the recombinant human-derived BTNL8 protein, expressed by HEK293, with C-hFc labeled tag. The total length of BTNL8 Protein, Human (HEK293, hFc) is 221 a.a., with molecular weight of approximately 65 kDa.

Background

BTNL8 protein potentially functions as a stimulator of the primary immune response, exerting its effects on T-cells that are sub-optimally stimulated through the TCR/CD3 complex. Its activity involves promoting the proliferation of T-cells and enhancing the production of cytokines.

Biological Activity

Measured by its ability to enhance anti-CD3-induced IFN-gamma secretion of mouse CTLL-2 cells. The ED50 for this effect is 2.028 μg/mL in the presence of 10μg/mL anti-CD3, corresponding to a specific activity is 493.097 U/mg.

  • Measured by its ability to enhance anti-CD3-induced IFN-gamma secretion of mouse CTLL-2 cells. The ED50 for this effect is 2.028 μg/mL in the presence of 10μg/mL anti-CD3, corresponding to a specific activity is 493.097 U/mg.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q6UX41-1 (Q18-K238)

Gene ID
Molecular Construction
N-term
BTNL8 (Q18-K238)
Accession # Q6UX41-1
hFc
C-term
Synonyms
Butyrophilin-like protein 8; BTNL8; Butyrophilin-like 8
AA Sequence

QWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEAMEVRFFRGQFSSVVHLYRDGKDQPFMQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQSYYQKAIWELQVSALGSVPLISITGYVDRDIQLLCQSSGWFPRPTAKWKGPQGQDLSTDSRTNRDMHGLFDVEISLTVQENAGSISCSMRHAHLSREVESRVQIGDTFFEPISWHLATK

Molecular Weight

approximately 65 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BTNL8 Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BTNL8 Protein, Human (HEK293, hFc)
Cat. No.:
HY-P79382
Quantity:
MCE Japan Authorized Agent: