C1QA Protein, Mouse (P.pastoris, His)

The C1QA protein helps form C1, the starting component of the serum complement system. C1q binds to the zymogens C1r and C1s, resulting in C1 assembly. C1QA Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived C1QA protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of C1QA Protein, Mouse (P.pastoris, His) is 223 a.a., with molecular weight of ~25.6 kDa.

C1QA protein plays a pivotal role in the formation of C1, the initiating component of the serum complement system. C1q associates with the proenzymes C1r and C1s, resulting in the assembly of C1. The collagen-like regions of C1q engage with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 occurs upon the interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibodies within immune complexes. Active C1 constitutes a calcium-dependent trimolecular complex composed of C1q, C1r, and C1s in a molar ratio of 1:2:2. The C1q subcomponent consists of nine subunits, with six forming disulfide-linked dimers of the A and B chains, and the remaining three forming disulfide-linked dimers of the C chain. Additionally, C1QA interacts via its C-terminus with CD33, activating CD33 inhibitory motifs.

Mouse

P. pastoris

N-6*His

P98086 (E23-A245)

12259  [NCBI]

EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA

Approximately 25.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.