CA125 Protein, Human (Biotinylated, HEK293, Fc-Avi)

The CA125 protein acts by binding to MSLN and plays a crucial role in forming a protective and lubricating barrier on mucosal surfaces. This interaction promotes heterotypic cell adhesion and is suggested to play an important role in peritoneal metastasis of ovarian cancer. CA125 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived CA125 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of CA125 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 264 a.a., with molecular weight of 80-120 kDa.

CA125 protein is believed to serve a crucial role in establishing a protective and lubricating barrier against particles and infectious agents at mucosal surfaces. It exerts its functions through binding to MSLN, where the interaction mediates heterotypic cell adhesion. This adhesive property may play a significant role in the metastasis of ovarian cancer to the peritoneum, as CA125 initiates cell attachment to the mesothelial epithelium by binding to MSLN. The interaction between CA125 and MSLN underscores its potential involvement in the adhesive events associated with cancer metastasis, particularly in the context of ovarian cancer progression to the peritoneal cavity.

Human

HEK293

C-Avi;C-hFc

Q8WXI7 (G12660-M12923)

94025  [NCBI]

GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM

80-120 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.