1. Recombinant Proteins
  2. CAR-T Related Proteins
  3. CA-125
  4. CA125 Protein, Human (HEK293, His)

CA125 is a giant mucin-like glycoprotein expressed by epithelial ovarian neoplasms and cells, which is an antigenic tumor marker. CA125 provides a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. CA125 binds to mesothelin (MSLN) mediates heterotypic cell adhesion, contributing to the metastasis of ovarian cancer to the peritoneum by initiating cell attachment to the mesothelial epithelium. CA125 is widely used for monitoring with ovarian epithelial cancer. CA125 Protein, Human (HEK293, His) is a recombinant human cancer antigen 125 (CA125) with a His label and is expressed in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CA125 is a giant mucin-like glycoprotein expressed by epithelial ovarian neoplasms and cells, which is an antigenic tumor marker. CA125 provides a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. CA125 binds to mesothelin (MSLN) mediates heterotypic cell adhesion, contributing to the metastasis of ovarian cancer to the peritoneum by initiating cell attachment to the mesothelial epithelium. CA125 is widely used for monitoring with ovarian epithelial cancer. CA125 Protein, Human (HEK293, His) is a recombinant human cancer antigen 125 (CA125) with a His label and is expressed in HEK293 cells[1][2][3][4][5][6][7].

Background

CA125 Protein (Human) is a counter receptor for galectin-1, as both soluble and membrane-associated fragments of CA125 derived from HeLa cell lysates are shown to bind specifically to human galectin-1 with high efficiency[1].
CA125 Protein (Human) is one of the mucin family proteins and is a serum tumor marker for various tumors, such as ovarian cancer, endometrial cancer, pancreatic cancer and bladder cancer[2].
CA-125 Protein (Human) is correlated with both peritoneal carcinomatosis on the diaphragm and residual disease (RD): A CA-125 (Human) value above 500 U/ml induction on the risk of diaphragmatic carcinomatosis is 3.5 times higher and the risk for residual disease of any size is increased by 2.4 times[3].
CA125 Protein (Human) is an antigen epitope found on mucin 16 (MUC16), a glycoprotein antigen present on the cell surface. Currently, 3 antibodies can help identify the CA125 antigen: OC125-like antibodies, M11-like antibodies and OV197-like antibodies. Postmenopausal women with a CA125 Protein (Human) level higher than 35 U/mL are considered to have a high risk of a malignancy[4].
CA125 Protein (Human) affects the cellular function of cancer cells, including fending off cytotoxic natural killer cell attacks and modulating intracellular signaling pathways in cancer cells or noncancer cells in the tumor-microenvironment (TM)[5].

In Vitro

The N-, O-linked sugar moieties and and the proteinaceous core structure of CA125 Protein (Human) contribute to the specificity of galectin recruitment. Additionally, CA125-C-TERM binding to galectin-1 largely depends on O-linked β-galactose-terminated oligosaccharide chains[1].
The expression levels of M2 macrophage marker, CD163 and regulatory T-cell (Treg) marker, FOXP3 are higher in CD125 Protein (Human)-high group than in CD125 Protein (Human)-low group, suggesting CD125 Protein (Human)-high bladder cancers have the immunosuppressive tumor-microenvironment (iTM)[5].

In Vivo

The affinity of CA125 protein (Human) for monoclonal antibody 196-14 is higher than that for monoclonal antibody 196-28 in nude mice bearing OVA-5 xenografts[7].

Biological Activity

1. Immobilized Human Mesothelin (HY-P700426) at 10 μg/mL (100 μl/well) can bind recombinant Human CA125, His (HEK293-expressed) (rHuCA125, His).The ED50 of recombinant Human CA125, His (HEK293-expressed) (rHuCA125, His) is ≤2 μg/mL.
2. Immobilized Recombinant Human MPF (HY-P70413) Protein at 2 μg/mL (100 μl/well) can bind Biotinylated Recombinant Human CA125 Protein. The ED50 for this effect is 5.731 ng/mL, corresponding to a specific activity is 1.74×105 Unit/mg.

  • Immobilized Recombinant Human MSLN/Mesothelin Protein at 2 μg/mL (100 μl/well) can bind Biotinylated Recombinant Human CA125 Protein. The ED50 for this effect is 5.731 ng/mL, corresponding to a specific activity is 1.74×105 Unit/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q8WXI7 (G12660-M12923)

Gene ID
Molecular Construction
N-term
CA125 (G12660-M12923)
Accession # Q8WXI7
6*His
C-term
Synonyms
rHuCA125, His; CA125 ovarian cancer antigen; CA125; CA125MUC-16;
AA Sequence

GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGMHHHHHH

Molecular Weight

40-80 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 50 mM Tris, 100 mM Glycine, pH 7.5 or 50 mM Tris-HCL, 300 mM NaCl, 100 mM Glycine, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

CA125 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CA125 Protein, Human (HEK293, His)
Cat. No.:
HY-P7696
Quantity:
MCE Japan Authorized Agent: