1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. Cell Adhesion Molecule 3 (CADM3)
  6. CADM3 Protein, Human (HEK293, His)

CADM3 Protein is crucial for cell-cell adhesion through calcium-independent homophilic and heterophilic interactions with IGSF4, NECTIN1, and NECTIN3. It can regulate cell-cell junctions through its interaction with EPB41L1. CADM3 Protein forms homodimers and trans-heterodimers with NECTIN3, and interacts with EPB41L1, DLG3, PALS2, and CASK. CADM3 Protein, Human (HEK293, His) is the recombinant human-derived CADM3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CADM3 Protein is crucial for cell-cell adhesion through calcium-independent homophilic and heterophilic interactions with IGSF4, NECTIN1, and NECTIN3. It can regulate cell-cell junctions through its interaction with EPB41L1. CADM3 Protein forms homodimers and trans-heterodimers with NECTIN3, and interacts with EPB41L1, DLG3, PALS2, and CASK. CADM3 Protein, Human (HEK293, His) is the recombinant human-derived CADM3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CADM3 Protein plays a critical role in cell-cell adhesion by engaging in both calcium-independent homophilic cell-cell adhesion and calcium-independent heterophilic cell-cell adhesion with IGSF4, NECTIN1, and NECTIN3. Its interaction with EPB41L1 has the potential to regulate the structure or function of cell-cell junctions (By similarity). CADM3 Protein forms a homodimer and can also form trans-heterodimers with NECTIN3. Additionally, CADM3 Protein interacts with EPB41L1, DLG3, PALS2, and CASK (By similarity).

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q8N126-1 (N25-H330)

Gene ID
Molecular Construction
N-term
CADM3 (N25-H330)
Accession # Q8N126-1
6*His
C-term
Synonyms
rHuCell adhesion molecule 3/CADM3, His; Cell Adhesion Molecule 3; Brain Immunoglobulin Receptor; Immunoglobulin Superfamily Member 4B; IgSF4B; Nectin-Like Protein 1; NECL-1; Synaptic Cell Adhesion Molecule 3; SynCAM3; TSLC1-Like Protein 1; TSLL1; CADM3; IGSF4B; NECL1; SYNCAM3; TSLL1
AA Sequence

NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYH

Molecular Weight

35-42 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CADM3 Protein, Human (HEK293, His)
Cat. No.:
HY-P70083
Quantity:
MCE Japan Authorized Agent: