Calcitonin R Protein, Human (HEK293, hFc)

Calcitonin R protein, a receptor for calcitonin, utilizes G proteins to activate adenylyl cyclase. Despite being sensitive to cholera toxin, it exhibits limited coupling to G proteins, leading to the inability to effectively activate adenylyl cyclase. Notably, following ligand binding, Calcitonin R does not undergo the conventional process of receptor internalization. Calcitonin R Protein, Human (HEK293, hFc) is the recombinant human-derived Calcitonin R, expressed by HEK293 , with N-hFc labeled tag.

The Calcitonin R protein serves as a receptor for calcitonin, exerting its activity through G proteins that subsequently activate adenylyl cyclase. This receptor is believed to couple with a heterotrimeric G protein sensitive to cholera toxin. However, it is noteworthy that while the Calcitonin R serves as a receptor for calcitonin, it does not effectively couple to G proteins, resulting in the inability to activate adenylyl cyclase. Additionally, following ligand binding, this receptor does not undergo the typical process of receptor internalization.

Measured by its binding ability in a functional ELISA. Immobilized Human Calcitonin at 2μg/mL (100μL/well) can bind Biotinylated Human Calcitonin R. The ED₅₀ for this effect is 4.532 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human Calcitonin at 2μg/mL (100μL/well) can bind Biotinylated Human Calcitonin R. The ED₅₀ for this effect is 4.532μg/mL.

Human

HEK293

N-hFc

P30988 (A25-V154)

799  [NCBI]

AFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIV

Approximately 55-75 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.