Calreticulin-3/CALR3 Protein, Human

Calreticulin-3/CALR3 Protein, Human is a recombinant human Calreticulin-3 expressed in E. coli. Calreticulin (CRT) is a highly conserved chaperone-like lectin that regulates Ca²⁺ homeostasis and participates in protein quality control in the endoplasmic reticulum (ER)^[1].

The C-terminal domain of CRT3, which is rich in basic residues, is essential for retaining bri1-9 in the ER. CRT1 and CRT2, similar to the mammalian CRT1, have an acidic C-terminal domain and are co-expressed with known ER chaperones and folding catalysts, whereas CRT3 has a C-terminal domain enriched with basic residues such as histidine (His or H), arginine (Arg or R) and lysine (Lys or K) and is co-expressed with genes involved in plant stress responses^[1].

Human

E. coli

Tag Free

Q96L12 (T20-L384)

125972  [NCBI]

TVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL

Approximately 42.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Yidan Liu, et al. A conserved basic residue cluster is essential for the protein quality control function of the Arabidopsis calreticulin 3. Plant Signal Behav. 2013 Apr;8(4):e23864.  [Content Brief]