Carbonic Anhydrase 1 Protein, Human (His)

Carbonic Anhydrase 1 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic Anhydrase 1 (CA1) expression and CA1-mediated calcification are significantly associated with atherosclerosis (AS) progression^[1].

Carbonic anhydrase 1 (CA1) is a member of the carbonic anhydrase (CA) family that reversibly catalyzes the hydration of CO₂ to form HCO₃^-, which then rapidly binds to calcium ions to form calcium carbonate. CA1 was also highly expressed in human AS tissues and in rat vascular smooth muscle cells (VSMCs) with β-glycerophosphate-induced calcification^[1].

The esterase activity is determined to be greater than 24 pmol/min/μg.

Human

E. coli

C-6*His

P00915 (A2-F261)

759  [NCBI]

ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASFHHHHHH

25-35 kDa

Greater than 95% as determined by reducing SDS-PAGE. 

Solution

Supplied as a 0.2 μm filter solution of 12.5 mM Tris-HCl, 75 mM NaCl, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Lin Yuan, et al. Carbonic Anhydrase 1-Mediated Calcification Is Associated With Atherosclerosis, and Methazolamide Alleviates Its Pathogenesis  [Content Brief]