2. Recombinant Proteins
  3. Enzymes & Regulators
  4. Lyases (EC 4) Carbonic Anhydrase
  5. Carbonic Anhydrase 14 (CA-XIV)
  6. Carbonic Anhydrase 14 Protein, Mouse (HEK293, His)

Carbonic Anhydrase 14 Protein, Mouse (HEK293, His)

Cat. No.: HY-P70810
SDS Handling Instructions

The carbonic anhydrase 14 (CA14) protein catalyzes the reversible hydration of carbon dioxide, converting it into bicarbonate ions and protons.Its enzymatic activity is essential for physiological processes, regulating pH and maintaining acid-base balance.Carbonic Anhydrase 14 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carbonic Anhydrase 14 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg $160 Ask For Quote & Lead Time
50 μg $450 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The carbonic anhydrase 14 (CA14) protein catalyzes the reversible hydration of carbon dioxide, converting it into bicarbonate ions and protons.Its enzymatic activity is essential for physiological processes, regulating pH and maintaining acid-base balance.Carbonic Anhydrase 14 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carbonic Anhydrase 14 protein, expressed by HEK293 , with C-6*His labeled tag.
Background

The Carbonic Anhydrase 14 (CA14) protein is responsible for the reversible hydration of carbon dioxide, playing a key role in catalyzing the conversion of carbon dioxide to bicarbonate ions and protons. This enzymatic activity is fundamental in various physiological processes, contributing to the regulation of pH levels and the maintenance of acid-base balance. As a member of the carbonic anhydrase family, CA14 participates in the crucial biochemical reactions involved in carbon dioxide transport and buffering in tissues, emphasizing its significance in cellular homeostasis.
Species

Mouse
Source

HEK293
Tag

C-6*His
Accession

Q9WVT6 (A16-M290)
Gene ID
Molecular Construction
N-term
Ca14 (A16-M290)
Accession # Q9WVT6
6*His
C-term
Synonyms
Carbonic Anhydrase 14; Carbonate Dehydratase XIV; Carbonic Anhydrase XIV; CA-XIV; CA14;
AA Sequence

ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM

Molecular Weight

41-50 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
SDS (251 KB) Handling Instructions (2659 KB)

Carbonic Anhydrase 14 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase 14 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70810
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (251 KB) Français - FR (251 KB) Deutsch - DE (251 KB) Norwegian - NO (251 KB) Español - ES (251 KB) Swedish - SV (251 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.