Carbonic Anhydrase 2 Protein, Mouse (His)

Carbonic Anhydrase 2 Protein is a member of the carbonic anhydrase isozyme family, responsible for catalyzing the reversible hydration of carbon dioxide. Mutations in CA2 are linked to osteopetrosis and renal tubular acidosis. The gene exhibits biased expression in various tissues, notably in the stomach and colon. CA2 plays vital role in the regulation of ion transport and pH balance and is involved in many biological processes. Carbonic Anhydrase 2 Protein, Mouse (His) is the recombinant mouse-derived Carbonic Anhydrase 2 protein, expressed by HEK293 , with C-His labeled tag. The total length of Carbonic Anhydrase 2 Protein, Mouse (His) is 259 a.a., with molecular weight of 30-35 kDa.

Carbonic Anhydrase 2 (CA2) is a member of the carbonic anhydrase isozyme family, responsible for catalyzing the reversible hydration of carbon dioxide. Dysregulation of this enzyme is linked to conditions such as osteopetrosis and renal tubular acidosis. Two transcript variants encoding distinct isoforms have been identified. In addition to its fundamental role in carbon dioxide metabolism, the protein exhibits biased expression in various tissues, with notable levels in the stomach and colon, as well as eight other tissues. It can also hydrate cyanamide to urea. CA2 is essential for bone resorption and osteoclast differentiation. CA2 plays vital role in the regulation of ion transport and pH balance and is involved in many biological processes. Moreover, CA2 downregulation promoted HCC metastasis and invasion. It serves as a suppressor of HCC metastasis and EMT and is correlated with favorable overall survival (OS) in HCC patients^[1][2][3][4].

Measured by its esterase activity. The specific activity is > 400 pmol/min/µg.

Mouse

HEK293

C-His

AAH55291 (S2-K260)

12349  [NCBI]

SHHWGYSKHNGPENWHKDFPIANGDRQSPVDIDTATAQHDPALQPLLISYDKAASKSIVNNGHSFNVEFDDSQDNAVLKGGPLSDSYRLIQFHFHWGSSDGQGSEHTVNKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKIGPASQGLQKVLEALHSIKTKGKRAAFANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLREPITVSSEQMSHFRTLNFNEEGDAEEAMVDNWRPAQPLKNRKIKASFK

30-35 kDa

Greater than 95% as determined by reducing SDS-PAGE

Solution

Supplied as 0.22 μm filtered solution in PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.