Carbonic Anhydrase 3 Protein, Human (His)

Carbonic Anhydrase 3 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 3 (CA III) is a zinc metalloenzyme known to catalyze the reversible hydration of CO₂ to HCO₃^-[1].

Carbonic anhydrase III (CAIII) is a metabolic enzyme and a regulator for intracellular pH. CAIII is an ~30-kDa cytosolic protein present at high levels in liver, adipocytes, and skeletal muscles. It is a low activity enzyme among CA isozymes but is resistant to most sulfonamide inhibitors. CAIII may facilitate rapid conversion of glycolytic intermediates to oxaloacetate and citrate and stimulate their incorporation into fatty acids^[2].

Measured by its esterase activity.The specific activity is >5 pmoles/min/μg.

Human

E. coli

C-His

NP_005172.1 (A1-K260)

761  [NCBI]

MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK

28-30 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 25mM Tris, 150 mM NaCl, pH 8.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Brian P.Mahon, et al. Chapter 5 - Carbonic Anhydrase III. Carbonic Anhydrases as Biocatalysts, 2015, Pages 91-108.

  [2]. Han-Zhong Feng, et al. Carbonic Anhydrase III Is Expressed in Mouse Skeletal Muscles Independent of Fiber Type-Specific Myofilament Protein Isoforms and Plays a Role in Fatigue Resistance. Front Physiol. 2016 Dec 15;7:597.  [Content Brief]