Cardiotrophin-1/CTF1 Protein, Human (His)

Cardiotrophin-1/CTF1 Protein, Human (His) is an approximately 25.0 kDa human cardiotrophin-1 protein with a His-flag. Cardiotrophin-1belongs to the IL-6 family and can act as a cytoprotective molecule^[1].

Cardiotrophin-1 (CT-1) is a new member of the IL-6 family which also includes IL-6, IL-11, leukemia inhibitory factor (LIF), oncostatin M (OSM), and ciliary neurotrophic factor (CNTF)^[1].
Cardiotrophin-1 induce its biological effects through the shared signaling subunit, gp 130^[2].
Human CT-1 encodes a 201 amino acid (aa) residue protein that lacks a hydrophobic signal peptide. Human and mouse CT-1 share 80% aa sequence identity and exhibit cross-species activity. CT-1 is highly expressed in heart, skeletal muscle, liver, lung and kidney. Lower levels of CT-1 expression is also seen in testis and brain^[2].
CT-1 initiates downstream signaling pathways through the heterodimerization of gp130 and the LIF receptor beta subunit. A third alpha receptor subunit has been implicated in the receptor complex. Cardiotrophin-1 can acts as a cytoprotective molecule.
Recombinant Human Cardiotrophin-1, His is an approximately 25.0 kDa human cardiotrophin-1 protein with a His-flag. Cardiotrophin-1belongs to the IL-6 family and can act as a cytoprotective molecule^[1].

Human

E. coli

N-6*His

Q16619 (M1-A201)

1489  [NCBI]

HHHHHHMSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

Approximately 25.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. O Robledo, et al. Signaling of the cardiotrophin-1 receptor. Evidence for a third receptor component. J Biol Chem. 1997 Feb 21;272(8):4855-63.  [Content Brief]

  [2]. D Pennica, et al. Cardiotrophin-1: a multifunctional cytokine that signals via LIF receptor-gp 130 dependent pathways. Cytokine Growth Factor Rev. 1996 Jun;7(1):81-91.  [Content Brief]

  [3]. Miguel López-Yoldi, et al. Cardiotrophin-1: A multifaceted cytokine. Cytokine Growth Factor Rev. 2015 Oct;26(5):523-32.  [Content Brief]