1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Cardiotrophin-1
  5. Cardiotrophin-1/CTF1 Protein, Human (His)

Cardiotrophin-1/CTF1 Protein, Human (His) is an approximately 25.0 kDa human cardiotrophin-1 protein with a His-flag. Cardiotrophin-1belongs to the IL-6 family and can act as a cytoprotective molecule.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Cardiotrophin-1/CTF1 Protein, Human (His) is an approximately 25.0 kDa human cardiotrophin-1 protein with a His-flag. Cardiotrophin-1belongs to the IL-6 family and can act as a cytoprotective molecule[1].

Background

Cardiotrophin-1 (CT-1) is a new member of the IL-6 family which also includes IL-6, IL-11, leukemia inhibitory factor (LIF), oncostatin M (OSM), and ciliary neurotrophic factor (CNTF)[1].
Cardiotrophin-1 induce its biological effects through the shared signaling subunit, gp 130[2].
Human CT-1 encodes a 201 amino acid (aa) residue protein that lacks a hydrophobic signal peptide. Human and mouse CT-1 share 80% aa sequence identity and exhibit cross-species activity. CT-1 is highly expressed in heart, skeletal muscle, liver, lung and kidney. Lower levels of CT-1 expression is also seen in testis and brain[2].
CT-1 initiates downstream signaling pathways through the heterodimerization of gp130 and the LIF receptor beta subunit. A third alpha receptor subunit has been implicated in the receptor complex. Cardiotrophin-1 can acts as a cytoprotective molecule.
Recombinant Human Cardiotrophin-1, His is an approximately 25.0 kDa human cardiotrophin-1 protein with a His-flag. Cardiotrophin-1belongs to the IL-6 family and can act as a cytoprotective molecule[1].

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q16619 (M1-A201)

Gene ID
Molecular Construction
N-term
6*His
CTF1 (M1-A201)
Accession # Q16619
C-term
Synonyms
rHuCardiotrophin-1, His; Cardiotrophin-1; CT-1; CTF1
AA Sequence

HHHHHHMSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

Molecular Weight

Approximately 25.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

Cardiotrophin-1/CTF1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cardiotrophin-1/CTF1 Protein, Human (His)
Cat. No.:
HY-P7739
Quantity:
MCE Japan Authorized Agent: