1. Recombinant Proteins
  2. Others
  3. CART Protein, Human (HEK293)

CART Protein, Human (HEK293)

Cat. No.: HY-P74351
COA Handling Instructions

CART Protein, a satiety factor, intricately regulates feeding in connection with leptin and neuropeptide Y. It effectively suppresses regular and starvation-triggered feeding, robustly inhibiting neuropeptide Y-initiated feeding within the hypothalamus. Additionally, CART protein plays a pivotal role in fostering neuronal development and survival in vitro, extending beyond its appetite regulation function. CART Protein, Human (HEK293) is the recombinant human-derived CART protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $42 In-stock
10 μg $72 In-stock
50 μg $200 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

CART Protein, Human (HEK293) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CART Protein, a satiety factor, intricately regulates feeding in connection with leptin and neuropeptide Y. It effectively suppresses regular and starvation-triggered feeding, robustly inhibiting neuropeptide Y-initiated feeding within the hypothalamus. Additionally, CART protein plays a pivotal role in fostering neuronal development and survival in vitro, extending beyond its appetite regulation function. CART Protein, Human (HEK293) is the recombinant human-derived CART protein, expressed by HEK293 , with tag free.

Background

CART protein, a satiety factor intricately linked to the functions of leptin and neuropeptide Y, acts as an anorectic peptide by effectively suppressing both regular and starvation-triggered feeding. Furthermore, it robustly inhibits the feeding response initiated by neuropeptide Y and governed by leptin within the hypothalamus. Beyond its role in appetite regulation, CART protein also plays a pivotal role in fostering neuronal development and survival when studied in vitro.

Biological Activity

Measured by its ability to enhance proliferation of SH-SY5Y cells. The ED50 for this effect is 1.221 μg/mL, corresponding to a specific activity is 819.001 units/mg.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

Q16568/NP_004282.1 (Q28-L116)

Gene ID
Molecular Construction
N-term
CART (Q28-L116)
Accession # Q16568
C-term
Synonyms
Cocaine- and amphetamine-regulated transcript protein; CART; CARTPT
AA Sequence

QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL

Molecular Weight

Approximately 10 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 6.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CART Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CART Protein, Human (HEK293)
Cat. No.:
HY-P74351
Quantity:
MCE Japan Authorized Agent: