Cathepsin B Protein, Human (L26V, HEK293, His)

Cathepsin B Protein, a thiol protease, is crucial for intracellular protein degradation, cleaving matrix extracellular phosphoglycoprotein MEPE. It's implicated in solubilizing cross-linked TG/thyroglobulin in the thyroid follicle lumen. Associated with tumor invasion and metastasis, Cathepsin B signifies potential relevance in cancer-related pathways. Cathepsin B Protein, Human (L26V, HEK293, His) is the recombinant human-derived Cathepsin B protein, expressed by HEK293 , with C-His labeled tag and L26V, , , , mutation. The total length of Cathepsin B Protein, Human (L26V, HEK293, His) is 322 a.a., with molecular weight of 10-45 kDa.

Cathepsin B Protein, a thiol protease, is thought to play a crucial role in intracellular protein degradation and turnover. This enzyme cleaves matrix extracellular phosphoglycoprotein MEPE and is implicated in the solubilization of cross-linked TG/thyroglobulin within the thyroid follicle lumen. Beyond its role in cellular processes, Cathepsin B has been associated with tumor invasion and metastasis, highlighting its potential significance in cancer-related pathways.

Measured by its ability to cleave the fluorogenic peptide substrate Z-LR-AMC (HY-142021). Read at excitation and emission wavelengths of 380 nm and 460 nm. The specific activity is >2500 pmol/min/µg, as measured under the described conditions.

• 
  Measured by its ability to cleave the fluorogenic peptide substrate Z-LR-AMC. Read at excitation and emission wavelengths of 380 nm and 460 nm . The specific activity is 13852.704 pmol/min/µg, as measured under the described conditions.

Human

HEK293

C-His

P07858-1 (R18-I339, L26V)

1508  [NCBI]

RSRPSFHPVSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI

10-45 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 8.0 or PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.