Cathepsin E Protein, Mouse (HEK293, His)

Cathepsin E Protein, Mouse (HEK293, His) is an approximately 42.0 kDa mouse cathepsin E with a His tag. Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases.^[1].

Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases. As an intracellular, hydrolytic aspartic protease, Cathepsin E is mainly expressed in cells of the immune and gastrointestinal systems, lymphoid tissues, erythrocytes, and cancer cells^[1].
Cathepsin E functions by breaking down proteins through the hydrolysis of peptide bonds at a specific peptide sequence site. And Cathepsin E plays an important role in the degradation of proteins, the generation of bioactive proteins, and antigen processing^[2].
Mouse Cathepsin E is synthesized as a precursor protein, consisting of a signal peptide (residues 118), a propeptide (residues 1959), and a mature chain (residues 60397)^[3].

Mouse

HEK293

C-6*His

P70269 (S60-P397)

13034  [NCBI]

SCNVYSSVNEPLINYLDMEYFGTISIGTPPQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPSQSDTYTEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVDGQQFGESVKEPGQTFVNAEFDGILGLGYPSLAAGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQAYWQIALDGIQVGDTVMFCSEGCQAIVDTGTSLITGPPDKIKQLQEAIGATPIDGEYAVDCATLDTMPNVTFLINEVSYTLNPTDYILPDLVEGMQFCGSGFQGLDIPPPAGPLWILGDVFIRQFYSVFDRGNNQVGLAPAVPHHHHHH

Approximately 42.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells  [Content Brief]

  [2]. T Azuma, et al. Human gastric cathepsin E. Predicted sequence, localization to chromosome 1, and sequence homology with other aspartic proteinases. J Biol Chem  [Content Brief]

  [3]. P J Tatnell, et al. Cloning, expression and characterisation of murine procathepsin E. FEBS Lett. 1997 May 12;408(1):62-6.  [Content Brief]