1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL1
  6. I-309/CCL1 Protein, Human

I-309/CCL1 Protein, Human

Cat. No.: HY-P70463
SDS COA Handling Instructions

CCL1 Protein, Human is a cytokine that mediates inflammatory immune responses, viral infections, and tumorigenesis by interacting with the CCR8 chemokine receptor on the cell surface and attracting monocytes, natural killer cells, and immature B-cell nuclear dendritic cells. I-309/CCL1 Protein, Human is a recombinant human CCL1 (K24-K96) expressed by E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CCL1 Protein, Human is a cytokine that mediates inflammatory immune responses, viral infections, and tumorigenesis by interacting with the CCR8 chemokine receptor on the cell surface and attracting monocytes, natural killer cells, and immature B-cell nuclear dendritic cells. I-309/CCL1 Protein, Human is a recombinant human CCL1 (K24-K96) expressed by E. coli[1].

Background

CCL1 is a small glycoprotein belonging to the CC chemokine family with a molecular weight of approximately 15-16 kDa, known as small inducible cytokine I-309 in humans and TCA-3 in mice. CCL1 is secreted by activated monocytes, macrophages, T lymphocytes and endothelial cells and is chemotactic for monocytes but not for neutrophils[1]. CCL1 can be activated by interaction with the cell surface chemokine receptor CCR8, which induces Ca2+ influx, stimulates transient increases in cytoplasmic free calcium concentration in monocytes, and inhibits apoptosis in thymocyte lines via the RAS/MAPK pathway. Among others, CCR8 is constitutively expressed in monocytes, macrophages, Th2 and regulatory T lymphocytes and is the sole receptor for the human CCL1 and for the viral chemokine, vCCL1 (viral macrophage inflammatory protein 1). CCR8 has been shown to be associated with phagocytic macrophages and activated microglia in MS lesions and is directly related to demyelinating activity[2]. CCL1 is involved in inflammatory processes through leukocyte recruitment and can play a key role in angiogenesis and other viral and neoplastic processes. A number of single nucleotide polymorphisms (SNPs) in the CCL1 gene have been associated with the progression of chronic obstructive pulmonary disease (COPD). In parallel, CCL1 plays a role in various CNS functions and diseases and may be associated with neuroinflammatory disorders[3].

In Vitro

CCL1 (100 ng/mL, 3h) stimulates a 14-fold increase in human aortic smooth muscle cells (VSMCs) migration and induces VSMC chemotaxis. Also, it stimulates VSMC secretion of pro - MMP2 and induces MMP-2 mRNA[4].

Biological Activity

1. Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10.0-100.0 ng/mL.
2. Determined by its ability to chemoattract human monocytes population (THP-1). The ED50 for this effect is 64.65 ng/mL, corresponding to a specific activity is 1.547×104 U/mg.

  • Determined by its ability to chemoattract human monocytes population (THP-1). The ED50 this effect is 64.65 ng/mL, corresponding to a specific activity is 1.547×104 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P22362 (K24-K96)

Gene ID
Molecular Construction
N-term
CCL1 (K24-K96)
Accession # P22362
C-term
Synonyms
C-C Motif Chemokine 1; Small-Inducible Cytokine A1; T Lymphocyte-Secreted Protein I-309; CCL1; SCYA1
AA Sequence

KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK

Molecular Weight

Approximately 7-11 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

I-309/CCL1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
I-309/CCL1 Protein, Human
Cat. No.:
HY-P70463
Quantity:
MCE Japan Authorized Agent: