CCL11 Protein, Rat

CCL11 protein directly promotes eosinophil accumulation in allergic reactions, selectively affecting eosinophils without influencing other immune cells. It binds to CCR3, emphasizing its role in eosinophil-mediated processes. The interaction between CCL11 and its receptor provides insights into the regulation of allergic reactions. CCL11 Protein, Rat is the recombinant rat-derived CCL11 protein, expressed by E. coli , with tag free. The total length of CCL11 Protein, Rat is 74 a.a., with molecular weight of ~10 kDa.

CCL11 protein, in response to the presence of allergens, plays a direct role in promoting the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Notably, CCL11 selectively influences eosinophil recruitment without a similar effect on lymphocytes, macrophages, or neutrophils. This specific activity highlights its significance in orchestrating the allergic immune response. CCL11 achieves its effects through binding to CCR3, emphasizing the involvement of this chemokine in eosinophil-mediated processes. The intricate interaction between CCL11 and its receptor sheds light on the molecular mechanisms governing the selective recruitment of immune cells during allergic reactions, providing valuable insights into the regulation of inflammatory processes.

1.Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 0.1-1.0 μg/mL.
2.Measured by its ability to chemoattract THP‑1 human acute monocytic leukemia cells. The ED₅₀ for this effect is 6.052 ng/mL, corresponding to a specific activity is 1.65×10⁵ U/mg.

Rat

E. coli

Tag Free

P97545 (H24-P97)

29397  [NCBI]

HPGSIPTSCCFTMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTKLGKEICADPKKKWVQDATKHLDQKLQTPKP

Approximately 10 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.