CCL11 Protein, Rhesus macaque (N-His)

The CCL11 protein directly promotes eosinophil accumulation in response to allergens, a key feature of allergic inflammation, without significantly affecting lymphocytes, macrophages, or neutrophils. This selective recruitment highlights the specificity of CCL11 in the coordination of immune responses, particularly in allergy. CCL11 Protein, Rhesus macaque (N-His) is the recombinant Rhesus Macaque-derived CCL11 protein, expressed by E. coli , with N-6*His labeled tag. The total length of CCL11 Protein, Rhesus macaque (N-His) is 74 a.a., with molecular weight of ~11 kDa.

In response to the presence of allergens, the CCL11 protein plays a direct role in promoting the accumulation of eosinophils, which is a prominent characteristic of allergic inflammatory reactions, while showing no significant effect on lymphocytes, macrophages, or neutrophils. This selective recruitment underscores CCL11's specificity in orchestrating immune responses, particularly in the context of allergic reactions. The protein achieves this effect by binding to CCR3, emphasizing its engagement with specific receptors to regulate the migration and activation of eosinophils in response to allergenic stimuli.

Measured in a cell proliferation assay using HUVEC cells.The ED₅₀ for this effect is 2.326 ng/mL, corresponding to a specific activity is 4.30×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using HUVEC cells.The ED₅₀ for this effect is 2.326 ng/mL, corresponding to a specific activity is 4.30×10⁵ units/mg.

Rhesus Macaque

E. coli

N-6*His

Q8MIT7 (G24-P97)

574218  [NCBI]

GPDSVATTCCFTLTNKKIPLQRLESYRRIISGKCPQKAVIFKTKLAKDICADPKKKWVQDSMKYLDRKSPTPKP

Approximately 11 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.