2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. Chemokine & Receptors
  5. CC Chemokines
  6. CCL21
  7. CCL21C Protein, Mouse

CCL21C protein has dual functions of inhibiting hematopoiesis and inducing chemotaxis. In vitro, it selectively attracts thymocytes and activated T cells without affecting B cells, macrophages or neutrophils. CCL21C Protein, Mouse is the recombinant mouse-derived CCL21C protein, expressed by E. coli , with tag free. The total length of CCL21C Protein, Mouse is 110 a.a., with molecular weight of ~18 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg USD 60 In-stock
10 μg USD 150 In-stock
50 μg USD 375 In-stock
100 μg USD 600 In-stock
> 100 μg   Get quote  

Get it by April 11 for select sizes. Order within 21 hrs 37 mins.

or Bulk Inquiry

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CCL21C protein has dual functions of inhibiting hematopoiesis and inducing chemotaxis. In vitro, it selectively attracts thymocytes and activated T cells without affecting B cells, macrophages or neutrophils. CCL21C Protein, Mouse is the recombinant mouse-derived CCL21C protein, expressed by E. coli , with tag free. The total length of CCL21C Protein, Mouse is 110 a.a., with molecular weight of ~18 kDa.
Background

CCL21C protein exerts dual functions by inhibiting hemopoiesis and inducing chemotaxis. In vitro, it demonstrates chemotactic activity specifically for thymocytes and activated T-cells, with no significant effect on B-cells, macrophages, or neutrophils. Additionally, CCL21C acts as a potent chemoattractant for mesangial cells and exhibits preferential activity towards naive T-cells. Implicating a role in lymphocyte homing to secondary lymphoid organs, CCL21C binds to both CCR7 and CXCR3 receptors. Furthermore, it interacts with PDPN, leading to the relocalization of PDPN to the basolateral membrane. These findings underscore the diverse regulatory functions of CCL21C in immune cell behavior and tissue-specific responses.
Biological Activity

Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR7 .The ED50 for this effect is 37.24 ng/mL, corresponding to a specific activity is 2.69×10^4 U/mg.
Species

Mouse
Source

E. coli
Tag

Tag Free
Accession

P86793 (S24-G133)
Gene ID

100042493  [NCBI]
Molecular Construction
N-term
CCL21C (S24-G133)
Accession # P86793
C-term
Synonyms
Ccl21c; Scya21cC-C motif chemokine 21c; 6Ckine; Beta-chemokine exodus-2; Small-inducible cytokine A21c; Thymus-derived chemotactic agent 4; TCA4
AA Sequence

SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

Molecular Weight

Approximately 18 kDa band in SDS-PAGE under reducing conditions.
Purity

Greater than 95% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.
Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.
Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping

Room temperature in continental US;may vary elsewhere.
Documentation
Data Sheet (235 KB) SDS (251 KB)

COA (219 KB)

Handling Instructions (2659 KB)

CCL21C Protein, Mouse Related Classifications

Help & FAQs
  • How should lyophilized recombinant proteins be reconstituted and stored?

    1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss. 2. Taking 10 μg as an example, first add 20 μL of reconstituted solution provided by MCE and use a pipette to gently resuspend the lyophilized protein until it is fully dissolved.. (For most proteins, the reconstitution solution we provide is sterile water. If a diluent other than water is required, it will be indicated in the product's Certificate of Analysis (COA).). 3. Add an additional 80 μL of buffer/culture medium containing carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% trehalose), and then use a pipette to gently mix until uniform. The final concentration is should not be lower than 100 μg/mL. 4. Aliquot at least 20 μL per tube. 5. After aliquoting, store it frozen at a temperature ranging from -20ºC to -80ºC, and it can be preserved for 3 to 6 months.

  • How should solution-form recombinant proteins be stored?

    1. The product can be stored in its original form and diluted as needed upon use. 2. Alternatively, dilute with a buffer/culture medium containing a carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% alginate), mix well by pipetting, and ensure that

  • Why is it necessary to add carrier proteins?

    Carrier proteins are commonly added to enhance the stability of recombinant proteins, preventing them from adhering to the walls of the container during freezing or thawing processes. Plastic tubes have a certain adsorptive capacity for proteins, which may lead to difficulty in separating the protein from the tube walls, resulting in a decrease in the actual concentration of the protein in the solution and thus affecting its activity. To minimize such losses, it is recommended to add a commonly used carrier protein solution prior to the long-term storage of recombinant protein products.

  • Carrier protein types and options?

    In cases where the carrier protein is not expected to influence the experimental outcomes, an appropriate carrier protein, such as 0.1% BSA (Bovine Serum Albumin), 5% HSA (Human Serum Albumin), 10% FBS (Fetal Bovine Serum), or 5% trehalose, can be incorpo

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCL21C Protein, Mouse
Cat. No.:
HY-P71892
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (251 KB) Français - FR (251 KB) Deutsch - DE (251 KB) Norwegian - NO (251 KB) Español - ES (251 KB) Swedish - SV (251 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.