TECK/CCL25 Protein, Mouse

The CCL25 protein emerged as a potential coordinator of T cell development, suggesting its involvement in the complex process of T cell maturation. Its recombinant form exhibits chemotactic activity against various immune cell types, including thymocytes and macrophages, by binding to the chemokine receptor CCR9. TECK/CCL25 Protein, Mouse is the recombinant mouse-derived TECK/CCL25 protein, expressed by E. coli , with tag free.

CCL25 Protein emerges as a potential participant in T-cell development, suggesting a role in orchestrating the intricate processes associated with T-cell maturation. The recombinant form of CCL25 displays chemotactic activity on various immune cell types, including thymocytes, macrophages, THP-1 cells, and dendritic cells, while remaining inactive on peripheral blood lymphocytes and neutrophils. The protein exerts its effects by binding to the chemokine receptor CCR9, indicating its involvement in directing the migration of specific cell populations. Additionally, CCL25 binds to the atypical chemokine receptor ACKR4, facilitating the recruitment of beta-arrestin (ARRB1/2) to ACKR4. This diverse range of interactions underscores the potential regulatory role of CCL25 in immune cell trafficking and suggests its importance in the orchestration of immune responses and T-cell-related processes.

Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR9 .The ED₅₀ for this effect is 0.1269μg/mL, corresponding to a specific activity is 7880.221 U/mg.

Mouse

E. coli

Tag Free

O35903 (Q24-N144)

20300  [NCBI]

QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN

Predict MW: 14.15 kDa; Approximately 16 kDa band in SDS-PAGE under reducing conditions.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.22 μm solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.