CTACK/CCL27 Protein, Mouse

CTACK/CCL27 protein attracts skin-associated memory T-lymphocytes, mediating lymphocyte homing to the skin. It may also participate in embryonic cell migration. Nuclear forms of CCL27 induce cytoskeletal relaxation. The protein binds to CCR10, exists in monomeric, dimeric, and tetrameric forms, and heparin promotes oligomerization. Additionally, CCL27 interacts with TNFAIP6 through its Link domain. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free.

CCL27 protein acts as a chemotactic factor specifically attracting skin-associated memory T-lymphocytes, potentially playing a crucial role in mediating the homing of lymphocytes to cutaneous sites. This chemokine may also participate in cell migration during embryogenesis. Notably, nuclear forms of CCL27 may contribute to cellular migration by inducing cytoskeletal relaxation. The protein binds to the CCR10 receptor and exists in monomeric, dimeric, and tetrameric forms, with heparin avidly promoting oligomerization. Furthermore, CCL27 interacts with TNFAIP6, specifically via its Link domain.

Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with mouse CCR10. The ED₅₀ for this effect is 0.02838 μg/mL, corresponding to a specific activity is 3.524×10⁴ U/mg.

Mouse

E. coli

Tag Free

Q9Z1X0-1 (L26-N120)

100039863  [NCBI]

LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSHPQQQN

Approximately 12 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.