CTACK/CCL27 Protein, Human

CTACK/CCL27 Protein, Human is a CC chemokine that binds to the chemokine receptor CCR10, attracts skin-associated memory T lymphocytes, mediates lymphocyte homing to skin sites, and plays a key role in skin inflammation. CTACK/CCL27 Protein, Human a recombinant human CTACK/CCL27 (F25-G112) protein expressed by E. coli^[1][2].

CCL27, also known as skin T-cell attracting chemokine (CTACK), is a CC chemokine located on chromosome 9 in the human genome.CCL27 is abundantly expressed in basal keratin-forming cells. Expression is lowest in basal suprabasal keratin-forming cells of normal skin; however, they exhibit stronger CCL27 expression in lesions of human AD, contact dermatitis, and psoriasis. In addition, CCL27 is present in the dermal extracellular matrix (ECM) of the epidermal plexus, fibroblasts and endothelial cells, especially in inflamed skin . By binding to chemokine receptor 10 (CCR10), CCL27 regulates inflammation by promoting the migration of lymphocytes into the skin. CCL27 contributes to tissue-restricted leukocyte trafficking by exhibiting high receptor and tissue specificity, and induces inflammation by promoting lymphocyte migration into the skin.CCL27 induces expression of cultured normal human keratinocytes (NHEK) via the pro-inflammatory factors TNFα and IL-1^[1][2].

CCL27(human, intradermal injection, 0.2, 2.0 or 20 µg) induces the recruitment of lymphocytes and increases T lymphocytes as well as CD3+ lymphocytes in BALB/c mice^[3].

Human

E. coli

Tag Free

Q9Y4X3 (F25-G112)

10850  [NCBI]

FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG

Approximately 14 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM PB, 500 mM NaCl, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Lin Chen, et al. CCL27 is a critical factor for the development of atopic dermatitis in the keratin-14 IL-4 transgenic mouse model. Int Immunol. 2006 Aug;18(8):1233-42.  [Content Brief]

  [2]. Jette Lindorff Riis, et al. CCL27 expression is regulated by both p38 MAPK and IKKβ signalling pathways. Cytokine. 2011 Dec;56(3):699-707.  [Content Brief]

  [3]. Bernhard Homey, et al. CCL27-CCR10 interactions regulate T cell-mediated skin inflammation. Nat Med. 2002 Feb;8(2):157-65.  [Content Brief]