1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL27
  6. CTACK/CCL27 Protein, Human

CTACK/CCL27 Protein, Human

Cat. No.: HY-P7767
SDS COA Handling Instructions

CTACK/CCL27 Protein, Human is a CC chemokine that binds to the chemokine receptor CCR10, attracts skin-associated memory T lymphocytes, mediates lymphocyte homing to skin sites, and plays a key role in skin inflammation. CTACK/CCL27 Protein, Human a recombinant human CTACK/CCL27 (F25-G112) protein expressed by E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

CTACK/CCL27 Protein, Human Featured Recommendations:

Top Publications Citing Use of Products

Publications Citing Use of MCE CTACK/CCL27 Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CTACK/CCL27 Protein, Human is a CC chemokine that binds to the chemokine receptor CCR10, attracts skin-associated memory T lymphocytes, mediates lymphocyte homing to skin sites, and plays a key role in skin inflammation. CTACK/CCL27 Protein, Human a recombinant human CTACK/CCL27 (F25-G112) protein expressed by E. coli[1][2].

Background

CCL27, also known as skin T-cell attracting chemokine (CTACK), is a CC chemokine located on chromosome 9 in the human genome.CCL27 is abundantly expressed in basal keratin-forming cells. Expression is lowest in basal suprabasal keratin-forming cells of normal skin; however, they exhibit stronger CCL27 expression in lesions of human AD, contact dermatitis, and psoriasis. In addition, CCL27 is present in the dermal extracellular matrix (ECM) of the epidermal plexus, fibroblasts and endothelial cells, especially in inflamed skin . By binding to chemokine receptor 10 (CCR10), CCL27 regulates inflammation by promoting the migration of lymphocytes into the skin. CCL27 contributes to tissue-restricted leukocyte trafficking by exhibiting high receptor and tissue specificity, and induces inflammation by promoting lymphocyte migration into the skin.CCL27 induces expression of cultured normal human keratinocytes (NHEK) via the pro-inflammatory factors TNFα and IL-1[1][2].

In Vivo

CCL27(human, intradermal injection, 0.2, 2.0 or 20 µg) induces the recruitment of lymphocytes and increases T lymphocytes as well as CD3+ lymphocytes in BALB/c mice[3].

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9Y4X3 (F25-G112)

Gene ID
Molecular Construction
N-term
CCL27 (F25-G112)
Accession # Q9Y4X3
C-term
Synonyms
rHuCCL27; C-C Motif Chemokine 27; CC Chemokine ILC; Cutaneous T-Cell-Attracting Chemokine; CTACK; Eskine; IL-11 R-Alpha-Locus Chemokine; Skinkine; Small-Inducible Cytokine A27; CCL27; ILC; SCYA27
AA Sequence

FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG

Molecular Weight

Approximately 14 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 500 mM NaCl, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

CTACK/CCL27 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CTACK/CCL27 Protein, Human
Cat. No.:
HY-P7767
Quantity:
MCE Japan Authorized Agent: