1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MIP-1 beta/CCL4
  6. CCL4 Protein, Rat

CCL4 protein, a monokine, acts as a homodimer and displays inflammatory and chemokinetic properties. CCL4 Protein, Rat is the recombinant rat-derived CCL4 protein, expressed by E. coli , with tag free. The total length of CCL4 Protein, Rat is 69 a.a., with molecular weight of ~11 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CCL4 protein, a monokine, acts as a homodimer and displays inflammatory and chemokinetic properties. CCL4 Protein, Rat is the recombinant rat-derived CCL4 protein, expressed by E. coli , with tag free. The total length of CCL4 Protein, Rat is 69 a.a., with molecular weight of ~11 kDa.

Background

CCL4, a monokine, exhibits inflammatory and chemokinetic properties as it functions as a homodimer.

Biological Activity

Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5. The ED50 for this effect is 14.43 ng/mL, corresponding to a specific activity is 6.930×104 U/mg.

  • Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5.The ED50 for this effect is 14.43 ng/mL, corresponding to a specific activity is 6.930×104 U/mg.
Species

Rat

Source

E. coli

Tag

Tag Free

Accession

P50230 (A24-N92)

Gene ID
Molecular Construction
N-term
CCL4 (A24-N92)
Accession # P50230
C-term
Synonyms
Ccl4; Mip1b; Scya4C-C motif chemokine 4; Macrophage inflammatory protein 1-beta; MIP-1-beta; Small-inducible cytokine A4
AA Sequence

APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQICADPSEPWVNEYVNDLELN

Molecular Weight

Approximately 11 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0 or PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCL4 Protein, Rat
Cat. No.:
HY-P71899
Quantity:
MCE Japan Authorized Agent: