1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins
  3. Chemokine & Receptors T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins G-Protein-Coupled Receptors (GPCRs)
  4. CC Chemokine Receptor Chemokine Receptor
  5. CCR2/CD192
  6. CCR2 Protein, Mouse (N-His, C-Myc)

CCR2 Protein, Mouse (N-His, C-Myc)

Cat. No.: HY-P700541
SDS COA Handling Instructions

CCR2 protein is an important chemokine receptor that coordinates chemotaxis and migration by binding to CCL2, CCL7, and CCL12 and activating the PI3K cascade. In addition to chemokine signaling, CCR2 regulates T cell inflammatory cytokines, promotes Th17 cell generation, and promotes mature thymocyte output. CCR2 Protein, Mouse (N-His, C-Myc) is the recombinant mouse-derived CCR2 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag. The total length of CCR2 Protein, Mouse (N-His, C-Myc) is 55 a.a., with molecular weight of 13.6 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CCR2 protein is an important chemokine receptor that coordinates chemotaxis and migration by binding to CCL2, CCL7, and CCL12 and activating the PI3K cascade. In addition to chemokine signaling, CCR2 regulates T cell inflammatory cytokines, promotes Th17 cell generation, and promotes mature thymocyte output. CCR2 Protein, Mouse (N-His, C-Myc) is the recombinant mouse-derived CCR2 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag. The total length of CCR2 Protein, Mouse (N-His, C-Myc) is 55 a.a., with molecular weight of 13.6 kDa.

Background

CCR2, a pivotal protein, serves as a key functional receptor for chemokines such as CCL2, CCL7, and CCL12. Its engagement with CCL2 on monocytes and macrophages orchestrates chemotaxis and migration induction through the activation of the PI3K cascade, involving the small G protein Rac and lamellipodium protrusion. Beyond its role in chemokine signaling, CCR2 acts as a receptor for the beta-defensin DEFB106A/DEFB106B. This versatile receptor plays a crucial role in regulating T-cell inflammatory cytokines and T-cell differentiation, promoting the generation of T-helper 17 cells (Th17) during inflammation. Additionally, CCR2 is implicated in facilitating the export of mature thymocytes, enhancing directional movement in response to sphingosine-1-phosphate stimulation, and up-regulating S1P1R expression through JAK-STAT signaling. Moreover, CCR2's involvement in neuropathic pain, synaptic transmission modulation, and the recruitment of macrophages and monocytes to injury sites underscores its multifaceted impact in diverse physiological contexts. Interactions with proteins like ARRB1 and DEFB106A/DEFB106B further contribute to the intricate regulatory network orchestrated by CCR2.

Species

Mouse

Source

E. coli

Tag

C-Myc;N-10*His

Accession

P51683 (M1-A55)

Gene ID
Molecular Construction
N-term
10*His
CCR2 (M1-A55)
Accession # P51683
Myc
C-term
Synonyms
CCR2; chemokine (C-C motif) receptor 2; CMKBR2; CC CKR 2; CD192; CKR2; FLJ78302; MCP 1 R; CCR2A; CCR2B; CKR2A; CKR2B; MCP-1-R; CC-CKR-2
AA Sequence

MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGA

Molecular Weight

16 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCR2 Protein, Mouse (N-His, C-Myc)
Cat. No.:
HY-P700541
Quantity:
MCE Japan Authorized Agent: