CCR5 Protein, Mouse (P. pastoris, His)

CCR5 Protein, a receptor for inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, plays a crucial role in signal transduction by increasing intracellular calcium ion levels. It contributes to granulocytic lineage control and T-lymphocyte migration to infection sites, serving as a chemotactic receptor. Interactions with PRAF2, GRK2, ARRB1, ARRB2, and CNIH4 highlight CCR5's regulatory network complexity. Efficient ligand binding to CCL3/MIP-1alpha and CCL4/MIP-1beta requires sulfation, O-glycosylation, and sialic acid modifications. Glycosylation on Ser-6 is essential for optimal CCL4 binding. The stimulating effect on T-lymphocyte chemotaxis, observed in interaction with S100A4, emphasizes CCR5's multifaceted roles in immune responses and cellular signaling pathways. CCR5 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived CCR5 protein, expressed by P. pastoris, with N-6*His labeled tag. The total length of CCR5 Protein, Mouse (P. pastoris, His) is 92 a.a., with molecular weight of 12.6 kDa.

CCR5 Protein, functioning as a receptor for several inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, plays a pivotal role in transducing signals by elevating intracellular calcium ion levels. This receptor may contribute to the control of granulocytic lineage proliferation or differentiation and is integral to T-lymphocyte migration to infection sites, functioning as a chemotactic receptor. Interactions with PRAF2, GRK2, ARRB1, ARRB2, and CNIH4 further underscore the complexity of CCR5's regulatory network. Notably, efficient ligand binding to CCL3/MIP-1alpha and CCL4/MIP-1beta necessitates sulfation, O-glycosylation, and sialic acid modifications. Additionally, glycosylation on Ser-6 is essential for optimal CCL4 binding. The interaction with S100A4 highlights a stimulating effect on T-lymphocyte chemotaxis, emphasizing the multifaceted roles of CCR5 in immune responses and cellular signaling pathways.

Mouse

P. pastoris

N-6*His

P51682 (Q263-L354)

12774  [NCBI]

QEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL

12.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.