1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Chemokine & Receptors G-Protein-Coupled Receptors (GPCRs)
  4. CC Chemokine Receptor Chemokine Receptor
  5. CCR5
  6. CCR5 Protein, Mouse (P. pastoris, His)

CCR5 Protein, a receptor for inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, plays a crucial role in signal transduction by increasing intracellular calcium ion levels. It contributes to granulocytic lineage control and T-lymphocyte migration to infection sites, serving as a chemotactic receptor. Interactions with PRAF2, GRK2, ARRB1, ARRB2, and CNIH4 highlight CCR5's regulatory network complexity. Efficient ligand binding to CCL3/MIP-1alpha and CCL4/MIP-1beta requires sulfation, O-glycosylation, and sialic acid modifications. Glycosylation on Ser-6 is essential for optimal CCL4 binding. The stimulating effect on T-lymphocyte chemotaxis, observed in interaction with S100A4, emphasizes CCR5's multifaceted roles in immune responses and cellular signaling pathways. CCR5 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived CCR5 protein, expressed by P. pastoris, with N-6*His labeled tag. The total length of CCR5 Protein, Mouse (P. pastoris, His) is 92 a.a., with molecular weight of 12.6 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
20 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CCR5 Protein, a receptor for inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, plays a crucial role in signal transduction by increasing intracellular calcium ion levels. It contributes to granulocytic lineage control and T-lymphocyte migration to infection sites, serving as a chemotactic receptor. Interactions with PRAF2, GRK2, ARRB1, ARRB2, and CNIH4 highlight CCR5's regulatory network complexity. Efficient ligand binding to CCL3/MIP-1alpha and CCL4/MIP-1beta requires sulfation, O-glycosylation, and sialic acid modifications. Glycosylation on Ser-6 is essential for optimal CCL4 binding. The stimulating effect on T-lymphocyte chemotaxis, observed in interaction with S100A4, emphasizes CCR5's multifaceted roles in immune responses and cellular signaling pathways. CCR5 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived CCR5 protein, expressed by P. pastoris, with N-6*His labeled tag. The total length of CCR5 Protein, Mouse (P. pastoris, His) is 92 a.a., with molecular weight of 12.6 kDa.

Background

CCR5 Protein, functioning as a receptor for several inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, plays a pivotal role in transducing signals by elevating intracellular calcium ion levels. This receptor may contribute to the control of granulocytic lineage proliferation or differentiation and is integral to T-lymphocyte migration to infection sites, functioning as a chemotactic receptor. Interactions with PRAF2, GRK2, ARRB1, ARRB2, and CNIH4 further underscore the complexity of CCR5's regulatory network. Notably, efficient ligand binding to CCL3/MIP-1alpha and CCL4/MIP-1beta necessitates sulfation, O-glycosylation, and sialic acid modifications. Additionally, glycosylation on Ser-6 is essential for optimal CCL4 binding. The interaction with S100A4 highlights a stimulating effect on T-lymphocyte chemotaxis, emphasizing the multifaceted roles of CCR5 in immune responses and cellular signaling pathways.

Species

Mouse

Source

P. pastoris

Tag

N-6*His

Accession

P51682 (Q263-L354)

Gene ID
Molecular Construction
N-term
6*His
CCR5 (Q263-L354)
Accession # P51682
C-term
Synonyms
CCR5; chemokine (C-C motif) receptor 5 (gene/pseudogene); chemokine (C C motif) receptor 5, CMKBR5; C-C chemokine receptor type 5; CC CKR 5; CD195; CKR 5; CKR5; IDDM22; chemr13; HIV-1 fusion coreceptor; chemokine receptor CCR5; C-C motif chemokine receptor 5 A159A; CCR-5; CKR-5; CCCKR5; CMKBR5; CC-CKR-5; FLJ78003;
AA Sequence

QEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL

Molecular Weight

12.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCR5 Protein, Mouse (P. pastoris, His)
Cat. No.:
HY-P700540
Quantity:
MCE Japan Authorized Agent: