CCR8 Protein, Human (P. pastoris, His)

CCR8 Protein-VLP, a receptor for CCL1/SCYA1/I-309, may regulate monocyte chemotaxis and thymic cell line apoptosis. It also acts as an alternative coreceptor with CD4 for HIV-1 infection, facilitating viral entry. The interaction with CCL1 highlights its role in mediating cellular responses to this chemokine, implying a regulatory function in immune and inflammatory processes. CCR8 Protein, Human (P. pastoris, His) is the recombinant human-derived CCR8 protein, expressed by P. pastoris, with C-Myc, C-6*His labeled tag. The total length of CCR8 Protein, Human (P. pastoris, His) is 35 a.a., with molecular weight of 7.7 kDa.

The CCR8 Protein-VLP acts as a receptor for the chemokine CCL1/SCYA1/I-309, potentially regulating monocyte chemotaxis and thymic cell line apoptosis. It also serves as an alternative coreceptor with CD4 for HIV-1 infection, implicating its involvement in facilitating viral entry and infection. The interaction between CCR8 and CCL1 underscores its role in mediating cellular responses to this chemokine, suggesting a regulatory function in immune and inflammatory processes.

Human

P. pastoris

C-Myc;C-6*His

P51685 (M1-K35)

1237  [NCBI]

MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK

7.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.