CD117/c-kit Protein, Rat (HEK293, His)

CD117, also known as tyrosine-protein kinase KIT or mast/stem cell growth factor receptor (SCFR), is a cytokine receptor that is expressed on the surface of hematopoietic stem cells and other cell types. CD117 signaling pathway plays an important role in cell survival, proliferation and differentiation. CD117 is a proto-oncogene associated with tumor development. CD117/c-kit Protein, Rat (HEK293, His) is the recombinant rat-derived CD117/c-kit protein, expressed by HEK293 , with C-His labeled tag.

The CD117 protein is a protein encoded by the proto-oncogene c-KIT, also known as the tyrosine-protein kinase KIT or mast/stem cell growth factor receptor (SCFR). CD117 is a cytokine receptor expressed on the surface of hematopoietic stem cells and other cell types. Altered forms of this receptor may be associated with certain types of cancer. CD117 is a receptor tyrosine kinase type III that binds to stem cell factors to form a dimer that activates its inherent tyrosine kinase activity, which in turn phosphorylates and activates signal transduction molecules that propagate signals through the cell. CD117 signaling pathway plays an important role in cell survival, proliferation and differentiation. CD117 signaling is necessary for the survival of melanocytes, and it is also involved in hematopoiesis and gametogenesis^[1][2][3][4].

Measured by its binding ability in a functional ELISA. When Recombinant Rat CD117/c-kit is present at 0.5 μg/mL, can bind Biotinylated Recombinant Mouse SCF/c-kit Ligand. The ED₅₀ for this effect is 10.95 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Rat CD117/c-kit is present at 0.5 μg/mL, can bind Biotinylated Recombinant Mouse SCF/c-kit Ligand. The ED₅₀ for this effect is 10.95 ng/mL.

Rat

HEK293

C-10*His

Q63116 (Q26-T522)

64030  [NCBI]

QPSASPGEPSPPSIQPAQSELIVEAGDTIRLTCTDPAFVKWTFEILDVRIENKQSEWIREKAEATHTGKYTCVSGSGLRSSIYVFVRDPAVLFLVGLPLFGKEDNDALVRCPLTDPQVSNYSLIECDGKSLPTDLKFVPNPKAGITIKNVKRAYHRLCIRCAAQREGKWMRSDKFTLKVRAAIKAIPVVSVPETSHLLKEGDTFTVICTIKDVSTSVDSMWIKLNPQPQSKAQVKRNSWHQGDFNYERQETLTISSARVNDSGVFMCYANNTFGSANVTTTLKVVEKGFINIFPVKNTTVFVTDGENVDLVVEFEAYPKPEHQQWIYMNRTPTNRGEDYVKSDNQSNIRYVNELRLTRLKGTEGGTYTFLVSNSDVSASVTFDVYVNTKPEILTYDRLMNGRLQCVAAGFPEPTIDWYFCTGAEQRCTVPVPPVDVQIQNASVSPFGKLVVQSSIDSSVFRHNGTVECKASNAVGKSSAFFNFAFKGNSKEQIQPHT

Approximately 60-110 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.