1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. CD14 B7-H3/CD276
  5. CD14 Protein, Mouse (HEK293, His-Fc)

CD14 Protein, Mouse (HEK293, His-Fc)

Cat. No.: HY-P75444
SDS COA Handling Instructions

CD14 protein is a key protein in the innate immune response and is significantly expressed in monocytes/macrophages. It acts as a coreceptor that binds various microbial and fungal molecules, including lipopolysaccharide (LPS). CD14 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived CD14 protein, expressed by HEK293 , with C-hFc, C-His, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $43 In-stock
10 μg $74 In-stock
50 μg $206 In-stock
100 μg $350 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE CD14 Protein, Mouse (HEK293, His-Fc)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD14 protein is a key protein in the innate immune response and is significantly expressed in monocytes/macrophages. It acts as a coreceptor that binds various microbial and fungal molecules, including lipopolysaccharide (LPS). CD14 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived CD14 protein, expressed by HEK293 , with C-hFc, C-His, C-6*His labeled tag.

Background

CD14 encodes a protein pivotal in the innate immune response and prominently expressed in monocyte/macrophage cells. Functioning as a co-receptor, it binds various microbial and fungal molecules, including lipopolysaccharides (LPS). The LPS-binding activity of this protein is potentiated by the LPS binding protein (LBP), facilitating binding to the TLR4-MD-2 co-receptor complex. CD14 exists in two forms—soluble and cell surface-anchored by a glycosylphosphatidylinositol anchor. Its broad expression is observed across diverse tissues, such as the mammary gland and colon, highlighting its crucial role in immune-related processes.

Biological Activity

Measured by its ability to enhance LPS-induced IL-6 secretion by CTLL-2 cells. The ED50 this effect is 468.3 ng/mL, corresponding to a specific activity is 2135.38 U/mg.

  • Measured by its ability to enhance LPS-induced IL-6 secretion by CTLL -2 cells. The ED50 this effect is 468.3 ng/ml, corresponding to a specific activity is 2135.38 U/mg.
Species

Mouse

Source

HEK293

Tag

C-hFc;C-His;C-6*His

Accession

P10810/NP_033971.1 (S16-P345)

Gene ID
Molecular Construction
N-term
CD14 (S16-P345)
Accession # P10810/NP_033971.1
hFc-6*His
C-term
Synonyms
Monocyte Differentiation Antigen CD14; CD14
AA Sequence

SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAP

Molecular Weight

85-95 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS, pH 7.4. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD14 Protein, Mouse (HEK293, His-Fc)
Cat. No.:
HY-P75444
Quantity:
MCE Japan Authorized Agent: